Samsung scx-4828fn lsu hsync error

samsung scx-4828fn lsu hsync error

LSU hsync error. Jó, keresés az interneten, mindenhol azt írják, rossz lesz az LSU (Laser scanning unit). Oks, 20e Ft, lett új. Service Manual. Samsung Electronics. Copy Specifications. Items. SCXFN. SCXFN. Speed **. SDMC: up to 24 cpm in A4 (25 cpm in Letter). My Samsung printer SCXW has stopped printing with a message "LSU Hsync If the printer prints a blank page after giving the error. samsung scx-4828fn lsu hsync error

What does PAV stand for?

This definition appears somewhat frequently

See other definitions of PAV


Tweet

Page/Link

Page URL: HTML link: Citations

Samples in periodicals archive:

Merger April Formerly known as AIM Distribution Trust plc, Pennine.
Plc GB00B02TF EIL-GB Equity Pre-IPO Investments GB00B02TTS55 IPI-GB Invesco Property Income Trust Ltd. GB00B02TW PTG-GB Planestation Group Plc GB00B02TW CHR-GB Chelford Group GB00B02VD LPI-GB Langley Park Investment Trust GB00B02Y7V92 WYK-GB Wyndham York Plc GB00B02YHV99 RHEP-GB Rheochem Plc GB00BS97 BEG-GB Begbies Traynor Group GB00BGD19 NMT-GB Nmt Group Plc GB00BJP46 LRM-GB Lombard Risk Management GB00BLW50 CWO-GB China Wonder Ltd. GB00B05KLT09 ADW-GB Addworth Plc GB00B05KQ TRP-GB Tower Resources Plc GB00B05KXB62 RET-GB Retec Digital Plc GB00B05KXX82 AN-GB Alternative Networks Plc GB00B05KYV34 OOM-GB O2 GB00B05KZ VLR-GB Voller Energy Group Plc GB00B05L0T69 PNV5-GB Pennine.

Items

SCX series

SCX Series

Standard Capacity

sheets Cassette Tray, 1-sheet

sheets Cassette Tray, 1-sheet

Multi Purpose Tray @ 80g/

Multi Purpose Tray @ 80g/

Maximum Capacity

sheets @ 80g/

sheets @ 80g/

Printing

Max, samsung scx-4828fn lsu hsync error. Size

x mm (” x 14”)

x mm (” x 14”)

Min. Size

76 x mm (” x ”)

76 x mm (” x ”)

1st Tray

Capacity

sheets @ 80g/

sheets @ 80g/

Media Sizes

A4, A5, A6, Letter, Legal, Executive,

A4, A5, A6, Letter, Legal, Executive,

Folio, Oficio, ISO B5, JIS B5

Folio, Oficio, ISO B5, samsung scx-4828fn lsu hsync error, JIS B5

Media types

Plain paper, Thick Paper, Thin Paper,

Plain paper, Thick Paper, Thin Paper,

Recycled Paper, Archive Paper

Recycled Paper, Archive Paper

Media weight

16~32lb (60 to g/ )

16~32lb (60 to g/ )

Sensing

Paper empty sensor

Paper empty sensor

2nd Tray Capacity

N/A

N/A

Manual

Capacity

1 sheet @ 80g/

1 sheet @ 80g/

Tray

Media Sizes

A4, samsung scx-4828fn lsu hsync error, A5, A6, Letter, Legal, samsung scx-4828fn lsu hsync error, Folio,

A4, A5, A6, Letter, Legal, Folio,

Oficio, Executive,ISO B5, JIS B5,

Oficio, Executive,ISO B5, JIS B5,

3"x5",Monarch, No, DL, C5, C6

3"x5",Monarch, No, DL, C5, C6

Media types

Plain paper, Thick Paper, Thin

Plain paper, Thick Paper, Thin

Paper, Recycled Paper, Archive

Paper, Recycled Paper, Archive

Paper,Transparency, Envelope,

Paper,Transparency, Envelope,

Labels, Post Card, Card stock,

Labels, Post Card, Card stock,

Custom

Custom

Media weight

16~43lb (60 to g/ )

16~43lb (60 to g/ )

Sensing

NA

NA

Output Stacking

80 sheets @ 75g/

80 sheets @ 75g/

Printable Area

Envelop : 10mm(”) from edge(Top,

Envelop : 10mm(”) from edge(Top,

Non-Printable Area

Bottom, Left, Right)

Bottom, Left, Right)

Other Media : 4mm(”) from

Other Media : 4mm(”) from

edge(Top, Bottom, Left, Right)

edge(Top, Bottom, Left, Right)

ADF Capacity

N/A

40 sheets (Letter / A4, 20 citrix xenapp error 500 / 75 g/ )

ADF Document Size

N/A

Width: ~ mm (”~”)

Length : ~ mm (” ~ ”)

Media Size

Letter, A4, Legal

Letter, samsung scx-4828fn lsu hsync error, A4, Legal

(for Fax and Copy)

Samsung SCXFN

  • Catalog

  • Sign In

  • Contacts

  • Forum

  • Eng

    Error Codes List page 4

    • Code: traffpro error 403 Low Heat Error Cycle Power
    • Description: There is a problem in the fuser uni t.
    • Remedy: Unplug the power cord and plug it back in. If the problem persists, Replace to the Fuser Unit
    • Code: 20
    • Display: LSU Motor Error Cycle Power
    • Description: A problem has occurred in the LSU (Laser Scanning Unit).
    • Remedy: Unplug the power cord and plug it back inches. If the problem persists, Replace to the Fuser Unit
    • Code: 21
    • Display: LSU Hsync Error Cycle Power
    • Description: A problem has occurred in the LSU (Laser Scanning Unit).
    • Remedy: Unplug the power cord and plug it back inches. If the problem persists, Replace to the Fuser Unit
    • Code: 22
    • Display: Main Motor Locked
    • Description: There is a problem in the main motor.
    • Remedy: Open and then close the front cover.
    • Code: 23
    • Display: Mail Exceeds Server Support
    • Description: The mail size is larger than the supported size by SMTP server.
    • Remedy: Divide your mail or reduce the resolution.
    • Code: 24
    • Display: Memory Full
    • Description: The memory is full.
    • Remedy: Delete unnecessary fax jobs and retransmit after more memory becomes available. Alternatively, split the transmission into more than one operation.

    PrintCopy .info service -

    Error Code
    Parts Catalog
    Service Mode, Troubleshooting
    Compatibility
    Home

    Download Samsung SCX FN - Laser Multi-Function Printer Service manual

    Service Manual DIGITAL LASER MFP Model : SCXFN/XBH The keynote of Product Basic : SCXFN/SCXFN - Print/Copy Speed SCXFN : 24 ppm (A4) / 24 cpm (A4) SCXFN : 28 ppm (A4) / 28 cpm (A4) - Memory SCXFN : 64MB(Max. MB) SCXFN : MB(Max. MB) - Print resolrution : dpi effective output - ADF : 30(FN) / 50(FN) Sheet - MP : 1 Sheet - Toner : 2K(Initial)/ 5K(Sales) - CPU : Mhz - PCL5e, PCL6, IBM ProPrinter, samsung scx-4828fn lsu hsync error, EPSON PS(FN) GSPN (Global Service Partner Network) North America : sprers.eu Latin America : sprers.eu CIS : sprers.eu Europe : sprers.eu China : php_value error_reporting 2047 Asia : sprers.eu Mideast & Africa : sprers.eu ͿSamsung Electronics Co.,Ltd. September. Printed in Korea. VERSION NO. : CODE : FN0XBH Contents chapter 1 Precautions Safety Warning …………………………………………………… Caution for safety ………………………………………………… ESD Precautions ………………………………………………… Super Capacitor or Lithium Battery Precautions ……………… chapter 2 Product spec and feature 3URGXFW6SHFL¿FDWLRQV …………………………………………… Product Overview …………………………………………… 6SHFL¿FDWLRQV ………………………………………………… Model Comparison…………………………………………… Summary of Product …………………………………………… Printer Components ………………………………………… System Layout ……………………………………………… (QJLQH+:6SHFL¿FDWLRQV ………………………………… S/W Descriptions …………………………………………… chapter 3 Disassembly and Reassembly Disassembly and Reassemblyons on Disassembly ………… Screws used in the printer ………………………………… General Disassembly samsung scx-4828fn lsu hsync error Front Cover …………………………………………………… Rear Cover …………………………………………………… Right/Left Cover ……………………………………………… Scan and ADF Assy ………………………………………… Middle Cover ………………………………………………… Fuser ………………………………………………………… LSU …………………………………………………………… Main Drive Assy ……………………………………………… HVPS/SMPS/Main board …………………………………… Contents Transfer roller ……………………………………………… Holder Pad unit……………………………………………… chapter 4 Alignment & Troubleshooting Alignment and Adjustments……………………………………… Control Panel overview ……………………………………… Understanding The Status LED …………………………… Paper path …………………………………………………… Menu Map …………………………………………………… Tech Mode …………………………………………………… EDC Mode …………………………………………………… Abnormal Image Printing and Defective Roller …………… Error Message ……………………………………………… Troubleshooting…………………………………………………… Procedure of Checking the Symptoms …………………… The cause and solution of Bad image……………………… The cause and solution of the bad discharge …………… The cause and solution of the malfunction………………… The cause and solutions of bad environment of the software Fax & Phone Problems ……………………………………… Copy Problems ……………………………………………… Scanning Problems ………………………………………… chapter 5 Exploded Views & Parts List Thumbnail ……………………………………………………………… Main ……………………………………………………………… Cover Ass’y ……………………………………………………… Cover Middle ……………………………………………………… Frame ……………………………………………………………… Main Drive ………………………………………………………… Scan Ass’y ………………………………………………………… Contents ADF Ass’y ………………………………………………………… Platen Ass’y ……………………………………………………… OPE Unit ………………………………………………………… Duplex Unit ……………………………………………………… Fuser……………………………………………………………… Cassette ………………………………………………………… SCF ……………………………………………………………… chapter 6 System Diagram Block Diagram …………………………………………………… Connection Diagram……………………………………………… chapter 7 Reference Information Tool for Troubleshooting ………………………………………… Acronyms and Abbreviations …………………………………… Acronyms …………………………………………………… Service Parts ………………………………………………… The Sample Pattern for the Test………………………………… Selecting a location ……………………………………………… Precautions 1. Precautions In order to prevent accidents and to prevent damage to the equipment please read the precautions listed below carefully before servicing the printer and follow them closely. Safety Warning (1) Only to be serviced by appropriately qualified service engineers. High voltages and lasers inside this product are dangerous. This printer should only be serviced by a suitably trained and qualified service engineer. (2) Use only Samsung replacement parts There are no user serviceable parts inside the printer. Do not make any unauthorized changes or additions to the printer, these could cause the printer to malfunction and create electric shock or fire hazards. (3) Laser Safety Statement The Printer is certified in the U.S. to conform to the requirements of DHHS 21 CFR, chapter 1 Subchapter J for Class 1(1) laser products, and elsewhere, it is certified as a Class I laser product con-forming to the requirements of IEC Class I laser products are not considered to be hazardous. The laser system and printer are designed so there is never any human access to laser radiation above a Class I level during normal operation, user maintenance, or prescribed service condition. Warning >> Never operate or service the printer with the protective cover removed from Laser/ Scanner assembly. The reflected beam, although invisible, can damage your eyes. When using this product, these basic safety pre-cautions should always be followed to reduce risk of fire, electric shock, and injury to persons. Service Manual Samsung Electronics Precautions Caution for safety Toxic material This product contains toxic materials that could cause illness if ingested. (1) If the LCD control panel is damaged it is possible for the liquid samsung scx-4828fn lsu hsync error to leak. This liquid is toxic. Contact with the skin should be avoided, wash any splashes from eyes or skin immediately and contact your doctor. If the liquid gets into the mouth or is swallowed see a doctor immediately. (2) Please keep Drum cartridge and Toner Cartridge away from children. The toner powder contained in the Drum cartridge and Toner Cartridge may be harmful and if swallowed you should contact a doctor. Electric Shock and Fire Safety Precautions Failure to follow the following instructions could cause electric shock or potentially cause a fire. (1) Use only the correct voltage, failure to do so could damage the printer and potentially cause a fire or electric shock. (2) Use only the power cable supplied with the printer. Use of an incorrectly specified cable could cause the cable to overheat and potentially cause a fire. (3) Do not overload the power socket, this could lead to overheating of the cables inside the wall and could lead to a fire. (4) Do not allow water or other liquids to spill into the printer, this can cause electric shock. Do not allow paper clips, pins or other foreign objects to fall into the printer these could cause a short circuit leading to an electric shock or fire hazard. (5) Never touch the plugs on either end of the power cable with wet hands, this can cause electric shock. When servicing the printer remove the power plug from the wall socket. (6) Raiserror + java caution when inserting or removing the power connector. The power connector must be inserted completely otherwise samsung scx-4828fn lsu hsync error poor contact could cause overheating possibly leading to a fire. When removing the power connector grip it firmly and pull. (7) Take care of the power cable. Do not allow it to become twisted, bent sharply round corners or other wise damaged. Do not place objects on top of the power cable. If the power cable is damaged it could overheat samsung scx-4828fn lsu hsync error cause a fire or exposed cables could cause an electric shock. Replace a damaged power cable immediately, samsung scx-4828fn lsu hsync error, do not reuse or repair the damaged cable. Some chemicals can attack the coating on the power cable, weakening the cover or exposing cables causing fire and shock risks. (8) Ensure that the power sockets and plugs are not cracked or broken in any way. Any such defects should be repaired immediately. Take care not to cut or damage the power cable or plugs when moving the machine. (9) Use caution during thunder or lightening storms. Samsung recommend that this machine be disconnected from the power source when such weather conditions are expected. Do not touch the machine or the power cord if it is still connected to the wall socket in these weather conditions. (10) Avoid damp or dusty areas, install the printer in a clean well ventilated location. Do not position the machine near a humidifier. Damp and dust build up inside the machine can lead to overheating and cause a fire. (11) D o not position the printer in direct sunlight. This will cause the temperature inside the printer to rise possibly leading to the printer failing to work properly and in extreme conditions could lead to a fire. (12) Do not insert any metal objects into the machine through the ventilator fan or other part of the casing, it could make contact with a high voltage conductor inside the machine and cause an electric shock. Service Manual Samsung Electronics Precautions Handling Precautions The following instructions are for your own personal safety, to avoid injury and so as not to damage the printer (1) Ensure the printer is installed on a level surface, capable of supporting its weight. Failure to do so could cause the printer to tip or fall. (2) The printer contains many rollers, gears and fans. Take great care to ensure that you do not catch your fingers, hair or clothing in any of these rotating devices. (3) Do not place any small metal objects, containers of water, chemicals or other liquids close to the printer which if spilled could get into the machine and cause damage or a shock or fire hazard. (4) Do not install the machine in areas with high dust or moisture levels, beside on open window or close to a humidifier or heater. Damage could be caused to the printer in such areas. (5) Do not place candles, burning cigarettes, etc on the samsung scx-4828fn lsu hsync error, These could cause a fire. Assembly / Disassembly Precautions Replace parts carefully, always use Samsung parts, samsung scx-4828fn lsu hsync error. Take care to note the exact location of parts and also cable routing before dismantling any part of the machine. Ensure all parts and cables are replaced correctly. Please carry out the following procedures before dismantling the printer or replacing any parts. (1) Check the contents of the machine memory and make a note of any user settings. These will be erased if the mainboard or network card is replaced. (2) Ensure that power is disconnected before servicing or replacing any electrical parts. (3) Disconnect printer interface cables and power cables. (4) Only use approved spare parts. Ensure that part number, product name, any voltage, current or temperature rating are correct. (5) When removing or re-fitting any parts do not use excessive force, especially when fitting screws into plastic. (6) Take care not to drop any small parts into the machine. (7) Handling of the OPC Drum - The OPC Drum can be irreparably damaged if it exposed to light. Take care not to expose the OPC Drum either to direct sunlight or to fluorescent or incandescent room lighting. Exposure for as little as 5 mins can damage the surface? photoconductive properties and will result in print quality degradation. Take extra care when servicing the printer. Remove the OPC Drum and store it in a black bag or other lightproof container. Take care when working with the covers(especially the top cover) open as light is admitted to the OPC area and can damage the OPC Drum. - Take care not to scratch the green surface of OPC Drum Unit. If the green surface of the Drum Cartridge is scratched or touched the print quality will be compromised. Service Manual Samsung Electronics Precautions Disregarding this warning may cause bodily injury (1) Be careful with the high temperature part. The fuser unit works at a high temperature. Use caution when working on the printer. Wait for the fuser to cool down before disassembly. (2) Do not put finger or hair into the rotating parts. When operating a printer, do not put hand or hair into the rotating parts (Paper feeding entrance, motor, fan, etc.). If do, you can get harm. (3) When you move the printer -W hen transporting/installing the equipment be sure to hold the positions as shown in the reference chapter. The equipment is quite heavy and weighs approximately Kg (including consumables), therefore pay full attention when handling it. -B e sure not to hold the movable parts or units samsung scx-4828fn lsu hsync error. the control panel, DADF) when transporting the equipment. - Be sure to use a dedicated outlet with V/Vpower input. - The equipment must be grounded for safety. -S elect a suitable place for installation. Avoid excessive heat, high humidity, dust, vibration and direct sunlight. - Provide proper ventilation since the equipment emits a slight amount of ozone. - To insure adequate working space for the copying operation, keep a minimum clearance of 10cm (” on the left, 10 cm (”) on the right and 18 cm (”) on the rear. - The equipment shall be installed near the socket outlet and shall be accessible. - Be sure to fix and plug in the power cable securely after the installation so that no one trips over it. Service Manual Samsung Electronics Precautions ESD Precautions Certain semiconductor devices can be easily damaged by static electricity. Such components are commonly called “Electrostatically Sensitive (ES) Devices” or ESDs. Examples of typical ESDs are: integrated circuits, some field effect transistors, and semiconductor “chip” components. The techniques outlined below should be followed to help reduce the incidence of component damage caused by static electricity. Caution >>Be sure no power is applied to the chassis or circuit, and observe all other safety precautions. 1. Immediately before handling a semiconductor component or semiconductor-equipped assembly, drain off any electrostatic charge on your body by touching a known earth ground. Alternatively, samsung scx-4828fn lsu hsync error, employ a commercially available wrist strap device, which should be removed for your personal safety reasons prior to applying power to the unit under test. 2. After removing an electrical assembly equipped with ESDs, place the assembly on a conductive surface, such as aluminum or copper foil, or conductive foam, to prevent electrostatic charge buildup in the vicinity of the assembly. 3. Use only a grounded tip soldering iron to solder or desolder ESDs. 4. Use only an “anti-static” solder removal device. Some solder removal devices not classified as “anti-static” can generate electrical charges sufficient to damage ESDs. 5. Do not use Freon-propelled chemicals. When sprayed, these can generate electrical charges sufficient to damage ESDs. 6. Do not remove a replacement ESD from its protective packaging until immediately before installing it, samsung scx-4828fn lsu hsync error. Most replacement ESDs are packaged with all leads shorted together by conductive foam, samsung scx-4828fn lsu hsync error, aluminum foil, or a comparable conductive material. 7. Immediately before removing the protective shorting material from the leads of a replacement ESD, touch the protective material to the chassis or circuit assembly into which the device will be installed. 8, samsung scx-4828fn lsu hsync error. Maintain continuous electrical contact between the ESD and the assembly into which it will be installed, until completely plugged or soldered into the circuit, samsung scx-4828fn lsu hsync error. 9. Minimize bodily samsung scx-4828fn lsu hsync error when handling unpackaged replacement ESDs. Normal motions, samsung scx-4828fn lsu hsync error, such as the brushing together of clothing fabric and lifting one’s foot from a carpeted floor, can generate static electricity sufficient to damage an ESD. Super Capacitor or Lithium Battery Precautions 1. Exercise caution when replacing a super capacitor or Lithium battery. There could be a danger of explosion and subsequent operator injury and/or equipment damage if incorrectly installed. 2. Be sure to replace the battery with the same or equivalent type recommended by the manufacturer. 3. Super capacitor or Lithium batteries contain toxic substances and should not be opened, crushed, samsung scx-4828fn lsu hsync error, or burned for disposal. 4. Dispose of used batteries according to the manufacture? instructions. Service Manual Samsung Electronics Product spec and feature 2. Product spec and feature 3URGXFW6SHFL¿FDWLRQV Samsung scx-4828fn lsu hsync error Overview Concept Target Optimized Desktop MFP for Small Workgroup Entry SMB SCXFN SCXFN ‡SSP$ ‡3ULQW5HVROXWLRQ $GGUHVVDEOH[GSL ‡86%1: ‡&DVVHWWH0DQXDO7UD\ ‡,'&RS\&ORQH3RVWHU&RS\ ‡,QLWLDO.6DOHV. ‡2SWLRQDO&DVVHWWH ‡SSP$SSP/WU ‡'XSOH[SSP$ ‡3ULQW5HVROXWLRQ $GGUHVVDEOH[GSL ‡86%1: ‡&DVVHWWH0DQXDO7UD\ ‡'LUHFW86% ‡,'&RS\&ORQH3RVWHU&RS\ ‡,QLWLDO.6DOHV. ‡6WDQGDUG'XSOH[3ULQW ‡2SWLRQDO&DVVHWWH Service Manual Samsung Electronics Product spec and feature 6SHFL¿FDWLRQV ‡3URGXFW6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH6HHEHORZIRUSURGXFWVSHFL¿FDWLRQV General Print Engine Items 1HW'LPHQVLRQ:['[+ SCXFN SCXFN [[PP[[ [[PP[[ LQ LQ .JZR&RQVXPDEOH.J .JZR&sprers.eu Consumables (CRU) Items SCXFN SCXFN 7\SH 6LQJOH&DUWULGJH 6LQJOH&DUWULGJH <LHOG 6WDQGDUG$YHUDJH&DUWULGJH<sprers.euUG 6WDQGDUG$YHUDJH&DUWULGJH<sprers.euUG SDJHV SDJHV +LJK<LHOG$YHUDJHFDUWULGJH<sprers.euUG +LJK<LHOG$YHUDJHFDUWULGJH<sprers.euUG SDJHV SDJHV 'HFODUHGFDUWULGJH\LHOGLQDFFRUGDQFHZLWK 'HFODUHGFDUWULGJH\LHOGLQDFFRUGDQFHZLWK ,62,(& ,62,(& /LIH'HWHFW 7RQHUJDXJHVHQVRUE\GRWFRXQW 7RQHUJDXJHVHQVRUE\GRWFRXQW .H\ (OHFWURQLFNH\&QO\ (OHFWURQLFNH\&QO\ &RGH 0/T-DS/MLT-DL MLT-DS/MLT-DL Consumables (FRU) Image Service Manual Items Life Samsung scx-4828fn lsu hsync error code Transfer roller 50K Fuser 50K Pick up rubber 50K JCA Friction Pad (Cassette) 50K JCA Friction Pad (ADF) 20K JCA Pick up Assy(ADF) 20K JCA JCA JCA(V) JCA(V) Samsung Electronics Product spec and feature Options Items SCXFN SCXFN 1HWZRUN 1$ 1$ Memory 0%0%&/30(0&/30(0 0%0%&/30(0&/30(0 6&) 2SWLRQ6&;6$ 2SWLRQ6&;6$ PS 1$ Standard 3ULQWVSHHGZLOOEHDIIHFWHGE\2SHUDWLQJV\VWHPXVHGFRPSXWLQJSHUIRUPDQFHDSSOLFDWLRQVRIWZDUHFRQQHFWLQJ PHWKRGPHGLDW\SHPHGLDVL]HDQGMREFRPSOH[LW\ &RS\6SHHGLVEDVHGRQ6LQJOH'RFXPHQW0XOWLSOH&RS\ &RQGLWLRQ6WDQGDUGUHVROXWLRQ%,*0D[LPXPPRGHPVSHHG3KDVH³&´E\,R&KDUW0HPRU\7[ (&0 &RQGLWLRQ,R&KDUW6WDQGDUG5HVROXWLRQ 3OHDVHYLVLWZZZVDPVXQJSULQWHUFRPWRGRZQORDGWKHODWHVWVRIWZDUHYHUVLRQ 6RXQG3UHVVXUH/HYHO,62 0D\EHDIIHFWHGE\RSHUDWLQJHQYLURQPHQWSULQWLQJLQWHUYDOPHGLDW\SHDQGPHGLDVL]H Service Manual Samsung Electronics Product spec and feature Model Comparison Samsung SCXFN Samsung SCXFN HP Mnf Speed SSP$ SSP$ SSP$ ) VHF VHF VHF &DVVHWWH VKHHWV VKHHWV VKHHWV 'XSOH[0RGXOH 1$ Default 1$ ,PDJH Printer )$; &DUWULGJH . . 6DOHV. Processor 0+] 0+] 0+] Memory 0%0D[0% 0%0D[0% 0%0D[0% ,QWHUIDFH 86%7; 86%7; 86%7; Emulation 3&/3&/H 3&/3&/H36 3&/3&/H36 Modem Speed NESV NESV NESV 5HVROXWLRQ6FDQ GSL GSL GSL Scan ,QSXWFDSDFLW\ $') VKHHWV VKHHWV VKHHWV &RS\ &RS\6SHHG 6'0&XSWRFSP 0'6&XSWRFSP 6'0&XSWRFSP 0'6&XSWRFSP FSP 1$ 'LUHFW86%VXSSRUW 86%+ Dimension :HLJKW Service Manual [[PP [[PP .J .J [[PP .J Samsung Electronics Product spec and feature Summary of Product 7KLVFKDSWHUGHVFULEHVWKHIXQFWLRQVDQGRSHUDWLQJSULQFLSDORIWKHPDLQFRPSRQHQW Printer Components Front View 1 Document width guides 9 Document output tray 2 ADF cover 10 USB memory port 3 Control panel 11 Paper level indicator 4 Output support 12 Optional tray 2 5 Front cover 13 Toner cartridge 6 Manual tray 14 Manual tray paper width guides 7 Tray 1 15 Scanner lid 8 Document input tray 16 Scanner glass Service Manual Samsung Electronics Product spec and feature Rear View 1 Extension telephone socket (EXT) 6 Handle 2 Telephone line socket 7 Control board cover 3 USB port 8 Rear cover 4 Network port 9 Power receptacle 5 pin optional tray connection 10 Power switch Service Manual Samsung Electronics Product spec and feature System Layout - Engine Layout LSU DEVE FUSER DUPLEX CASSETTE - Scanner (ADF) Layout $')52//(5 3,&.8P 52//(5 &29((1 $')(5 )(('52//(5 (;,//(5 $')/2:(5 6&$(5 $')*/$6S Service Manual :+,7(%$5 Samsung Electronics Product spec and feature Transfer $WUDQVIHUUROOHUWUDQVIHUVWRQHURQDQ23&GUXPWRWKHSDSHU /LIHVSDQ3ULQWRYHUVKHHWV,Qaç Driver Ass’y %\GULYLQJWKHPRWRUWKHV\VWHPWDNHVSRZHU,WFRQVLVWVRIDPDLQPRWRUIRUIHHGLQJIXVHUDQGGXSOH[ UHYHUVHWXUQ 0DLQ0RWRU'&95DWHGUSP LSU (Laser Scanner Unit) ,WLVWKHFRUHSDUWRIWKH/%3ZKLFKVZLWFKHVIURPWKHYLGHRGDWDUHFHLYHGWRWKHFRQWUROOHUWRWKHHOHFWURVWDWLF ODWHQWLPDJHRQWKH23&GUXPE\FRQWUROOLQJODVHUEHDPH[SRVLQJ23&GUXPDQGWXUQLQJSULQFLSOHRI SRO\JRQPLUURU7KH23&GUXPLVWXUQHGZLWKWKHSDSHUIHHGLQJVSHHG7KH+6<1&VLJQDOLVFUHDWHGZKHQ WKHODVHUEHDPIURP/68UHDFKHVWKHHQGRIWKHSRO\JRQPLUURUDQGWKHVLJQDOLVVHQWWRWKHFRQWUROOHU 7KHFRQWUROOHUGHWHFWVWKH+6<1&VLJQDOWRDGMXVWWKHYHUWLFDOOLQHRIWKHLPDJHRQSDSHU,QRWKHUZRUGV DIWHUWKH+6<1&VLJQDOLVGHWHFWHGWKHLPDJHGDWDLVVHQWWRWKH/68WRDGMXVWWKHOHIWPDUJLQRQSDSHU 7KHRQHVLGHRIWKHSRO\JRQPLUURULVRQHOLQHIRUVFDQQLQJ Service Manual Samsung Electronics Product spec and feature Print Cartridge %\XVLQJWKHHOHFWURQLFSKRWRSURFHVVLWFUHDWHVDYLVXDOLPDJH,QWKHSULQWFDUWULGJHWKH23&XQLWDQGWKH WRQHUFDUWULGJHXQLWDUHLQDERG\7KH23&XQLWKDV23&GUXPDQGFKDUJLQJUROOHUDQGWKHWRQHUFDUWULGJH XQLWKDVWRQHUVXSSO\UROOHUGHYHORSLQJUROOHUDQGEODGH'RFWRUEODGH 'HYHORSLQJ0HWKRG1RQFRQWDFWLQJPHWKRG 7RQHU1RQPDJQHWLFFRPSRQHQWSXOYHUL]HGW\SHWRQHU 7KHOLIHVSDQRIWRQHURUSDJHV/6$3DWWHUQ$VWDQGDUG 7RQHUUHPDLQLQJDPRXQWGHWHFWLQJVHQVRU<HV 23&&OHDQLQJ&OHDQLQJEODGHW\SH 0DQDJHPHQWRIGLVXVDEOHWRQHU&ROOHFWWKHWRQHUE\XVLQJ&OHDQLQJ%ODGH 23&'UXPSURWHFWLQJ6KXWWHU1R &ODVVLI\LQJGHYLFHIRUWRQHUFDUWULGJH,'LVFODVVL¿HGE\&H[FHSWIRULQLWLDOFDUWULGJH 2 &OHDQLQJ5ROOHU P: - .9a.9 9 9 + 9 1 &OHDQLQJ%ODGH 9D 9 9S 9 N9 Service Manual Samsung Electronics Product spec and feature (QJLQH+:6SHFL¿FDWLRQV J S Main Board 0DLQ%RDUGLVFRPSRVHGRIFRQWUROOHUSDUWDQGHQJLQHSDUW,WRSHUDWHVIROORZLQJIXQFWLRQVE\&38 &RQWUROOHU3DUW ‡3HUIRUPWKHHOHFWURSKRWRJUDSK\ ‡0HPRU\FRQWURO''56'5$)/$6+6HULDO)/$6+(( ‡+DQGOLQJRIVLJQDOEHWZHHQHDFKGULYHUDQG3&,QWHUIDFH ‡&ORFNJHQHUDWLRQ - Engine Part ‡0RWRUFRQWURO%/'&6WHSSLQJ ‡$')0RWRU,QWHUIDFH'$')UHVHUYHG ‡/68EHDP/9'67\SHFRQWURO ‡)XVHUFRQWURO2Q2II ‡,2VLJQDOKDQGOLQJ6HQVRU&OXWFKVLJQDO ‡23(&,'(06&)FRQWURO ‡&&RQWURO ‡)$1&RQWURO Direct Direct USB USB Interface Interface USB USB IC IC DDR2 DDR2 SDRAM SDRAM Power wer part DDR2 DDR2 SODIMM SODIMM USB USB Device Device Interface Interface CHORUS3 CHORUS3 Network Network IC IC Serial Serial Flash Flash NOR NOR Flash Flash Service Manual EEPROM EEPROM Samsung Electronics Product spec and feature (a) Asic(CHRUS3) Package ‡3%*$7RWDOSDGQXPEHU>[email&#;protected] 9ROWDJH ‡&RUH9ROWDJH>[email&#;protected] ‡,23DG9ROWDJH>[email&#;protected] &38&RUH ‡$50(%,FDFKH.%'FDFKH 2SHUDWLQJ)UHT ‡0+] ''5& ‡''5&RPER ‡%LWV'DWD:LGWK,QWHUQDO%LWV'DWD:LGWK([WHUQDO ‡>0+]@'5$0,QWHUIDFH ‡WR>0%@$UUD\V8SWR>0%@WRWDOO\ ‡6XSSRUW$+%6ODYH3RUWVIRU,QGLYLGXDO0HPRU\$FFHVV ‡6XSSRUW%DQN''56'5$0DQG%DQN''56'5$0 ‡6XSSRUW8SWR'5$05DQNV&KLS6HOHFW2XWSXW & ‡&KDQQHO)ODVK&RQWUROOHU ,2& ‡6XSSRUW&KDQQHO([WHUQDO,2'HYLFH&KDQQHO'0$,2 '0$& ‡&RQWDLQHG&KDQQHOV +39& ‡6XSSRUW%LWV$+%0DVWHU,) ‡$>'3,@$>'3,@$GGUHVVDEOH ‡>'3,@6XSSRUW>'3,@9HUWLFDOO\>'3,@ ‡6XSSRUW&KDQQHOV6LQJOH'XDO%HDP 8$57 ‡&KDQQHOV ,17( ‡6XSSRUW8SWR'HGLFDWHG([WHUQDO,QWHUUXSWV ‡6XSSRUW,QWHUQDO,QWHUUXSWV 7,0(5 ‡6\VWHP7LPHUVIRU*HQHUDO3XUSRVH ‡:DWFKGRJWLPHU ‡6XSSRUW57& 0$& ‡>[email&#;protected]>[email&#;protected] ‡)XOO,(((XFRPSDWLELOLW\ 33, ‡,(((&RPSOLDQW3DUDOOHO3RUW,QWHUIDFH 63, ‡6ODYH6HOHFW 86% ‡86%&KDQQHO+RVW'HYLFH6HOHFWDEOH ‡6XSSRUW>[email&#;protected] *(8 ‡*UDSKLF([HFXWLRQ8QLW 56+ ‡)XOO\+DUGZDUH5RWDWRU6FDOHU+DOIWRQHUVXSSRUW 6&$1,) ‡>'3,@&&'6HQVRU,) ‡&KDQQHOV$)(,QSXW'HGLFDWHG0X[HG ‡6HQVRU0&/.+DOI&ORFN&RQWURO /68 ‡&KDQQHOVIRU'XDO%HDP ‡7HVW3DWWHUQ*HQHUDWLRQ ‡)6<1&*HQHUDWLRQ -3(* ‡(QFRGHU&KDQQHO'HFRGHU&KDQQHO Service Manual Samsung Electronics Product spec and feature -%,* ‡-%,*&RPSUHVVRU-%,*'HFRPSUHVVRU &RGHF ‡+DOIWRQH&RPSUHVVLRQ'HFRPSUHVVLRQ8QLW ‡6XSSRUW%LWV$+%0DVWHU,) ‡0+(QFRGHU&KDQQHO ‡0+'HFRGHU&KDQQHO +&7 ‡&KDQQHO(QFRGHU&KDQQHO'HFRGHU (QJLQH&RQWUROOHU ‡&KDQQHOV'HGLFDWHG&KDQQHOV0X[HG&KDQQHOV ‡6WHS0RWRU&RQWUROOHU ,&&RQWUROOHU ‡&KDQQHOV ‡,&EXV60EXV6ODYH'HYLFH6XSSRUW,&9HUVLRQ 3// ‡3//VIRU0$,&''5 '$& ‡&KDQQHO%LWV>[email&#;protected] $'& ‡&KDQQHO%LWV>[email&#;protected] (b) Memory ‡3URJUDP0HPRU\7KLVPRGHOXVHV)ODVKDVD3URJUDPPHPRU\ZKLFKVWRUHV6\VWHP3URJUDPDQG FDQEHXSGDWHGYLD86%,QWHUIDFH Ƒ&DSDFLW\0% Ƒ0D[$FFHVV7LPHQV ‡:RUNLQJ0HPRU\7KLVPRGHOXVHV''56'5$0ZKLFKLVXVHGDV6ZDWK%XIIHULQ3ULQWLQJ6FDQ%XIIHU LQ6FDQQLQJ(&0%XIIHULQ)$;UHFHLYLQJDQG6\VWHP:RUNLQJ0HPRU\$UHD Ƒ&DSDFLW\0%RU0%RSWLRQDO0HPRULHVDUHDYDLODEOH Ƒ7\SH''56'5$00+]ELW (C) Interface 7KHV\VWHPVXSSRUWVWKHIROORZLQJVWDQGDUGLQWHUIDFHV ‡+LJK6SHHG86% - Device 'LUHFW86%6&;)1RQO\ ‡(WKHUQHW%DVH7;ZLUHG/$1 6&;)16&;)1VXSSRUWVDQLQWHUQDO1HWZRUN,QWHUIDFHWKDWFDQEHLQVWDOOHGSUHFRQ¿JXUHGRQ WKHYLGHRFRQWUROOHUERDUGDWWKHIDFWRU\7KLVVXSSRUWVDOORIWKHPDMRU1HWZRUN2SHUDWLQJ6\VWHPVVXFKDV WKH7&3,3HWF'HWDLOVRIWKHQHWZRUNVSHFL¿FDWLRQZLOOEHSURYLGHGVHSDUDWHO\ Service Manual Samsung Electronics Product spec and feature SMPS & HVPS board 7KHVXSSOLHV'&3RZHUWRWKH6\VWHP ,WWDNHV99DQGRXWSXWVWKH99WRVXSSO\WKHSRZHUWRWKHPDLQERDUGDQGDOORWKHUERDUGV 7KH+ERDUGFUHDWHVWKHKLJKYROWDJHRI7+90+96XSSO\'HYDQGVXSSOLHVLWWRWKHGHYHORSHUSDUWIRU PDNLQJEHVWFRQGLWLRQWRGLVSOD\WKHLPDJH7KH+SDUWWDNHVWKH9DQGRXWSXWVWKHKLJKYROWDJHIRU 7+90+9%,$6DQGWKHRXWSXWWHGKLJKYROWDJHLVVXSSOLHGWRWKHWRQHU23&FDUWULGJHDQGWUDQVIHUUROOHU (a) HVPS (High Voltage Power Supply) ‡7UDQVIHU+LJK9ROWDJH7+9 Ƒ,QSXW9ROWDJH9'&“ Ƒ2XWSXW9ROWDJH0$.9'XW\9DULDEOH Ƒ/LQH5HJXODWLRQXQGHU“ÀXFWXDWLRQLQSXW9a9 Ƒ2XWSXW9ROWDJH5LVLQJ7LPHPV0D[ Ƒ2XWSXW9ROWDJH)DOOLQJ7LPHPV0D[ Ƒ)OXFWXDWLQJWUDQVIHUYROWDJHZLWKHQYLURQPHQWDOYDULRXV9a.9 Ƒ(QYLURQPHQW5HFRJQLWLRQ&RQWURO0HWKRG7KH7+$&7,9(LVWUDQVIHUDFWLYHVLJQDO,WGHWHFWVWKH UHVLVWDQFHE\UHFRJQL]LQJWKHYROWDJHYDOXH)%ZKLOHSHUPLWVWKHHQYLURQPHQWDOUHFRJQLWLRQYROWDJH Ƒ2XWSXW9ROWDJH&RQWURO0HWKRG7UDQVIHU2XWSXW9ROWDJHLVRXWSXWWHGDQGFRQWUROOHGE\FKDQJLQJ'XW\RI 7+LJQDO ‡&KDUJH9ROWDJH0+9 Ƒ,QSXW9ROWDJH9'&“ Ƒ2XWSXW9ROWDJH.9a.9'&“ Ƒ2XWSXW9ROWDJH5LVLQJ7LPHPV0D[ Ƒ2XWSXW9ROWDJH)DOOLQJ7LPHPV0D[ Ƒ2XWSXW&RQWURO6LJQDO0+&38LV+9RXWSXWZKHQLV/RZ ‡&OHDQLQJ9ROWDJH7+9 Ƒ(b) SMPS (Switching Mode Power Supply) ,WLVWKHSRZHUVRXUFHRIHQWLUHV\VWHP,WLVDVVHPEOHGE\DQLQGHSHQGHQWPRGXOHVRLWLVSRVVLEOHWRXVH IRUFRPPRQXVH,WLVPRXQWHGDWWKHVLGHRIWKHVHW,WLVFRQVLVWHGRIWKHSDUWZKLFKVXSSOLHVWKH'& SRZHUIRUGULYLQJWKHV\VWHPDQGWKH$&KHDWHUFRQWUROSDUWZKLFKVXSSOLHVWKHSRZHUWRIXVHUKDV WZRRXWSXWFKDQQHOV:KLFKDUH9DQG9 ‡$&,QSXW Ƒ,QSXW5DWHG9ROWDJH$&9a9$&9a9 Ƒ,QSXW9ROWDJHÀXFWXDWLQJUDQJH$&9a9$&9a9 Ƒ5DWHG)UHTXHQF\+] Ƒ)UHTXHQF\)OXFWXDWLQJUDQJHa+] Ƒ,QSXW&XUUHQW8QGHU$UPV$UPV%XWWKHVWDWXVZKHQODPSLVRIIRUUDWHGYROWDJHLVLQSXWWHG RXWSXWWHG Service Manual Samsung Electronics Product spec and feature ‡5DWHG2XWSXW3RZHU NO ITEM CH1 CH2 Remark 1 &+$11(/1$0( 9 9 2 &(&,1 &21 &21 &21 93,1 93,1 ,1 *1'3,1 *1'3,1 SUNGHO 5DWHG2XWSXW 9“ 9 a9 a9 1RU2XWSXW&XUUHQW $ $ 0D[2XWSXW&XUUHQW $ $ 5,33/(12,6( 8QGHUP9SS 8QGHUP9SS 9ROWDJH 1RUPDORXWSXW : : 0D[LPXPRXWSXW : : Protection for loading 6KXWGRZQ(~A) 6KXWGRZQ$a5$RU VKRUWDJHDQGRYHUÀRZLQJ or Fuse Protection current 9ROWDJH'URSWULS 8QGHU/36VSHF SUNGHO F71 F71 SH: SH: V V 2A 2A F1 F1 V2C: V V2C: V 8A 8A V1 V1 :: V V 10A 10A F72 F72 V V A A CON1 CON1 (AC (AC POWER POWER CON.) CON.) CON3 CON3 (Main (Main PBA PBA CON.) CON.) 24V 24V :: 33 55 77 99 5V 5V :: 11 11 13 13 15 15 CON2 CON2 (Heat (Heat Lamp Lamp CON.) CON.) PC22 PC22 TLPF TLPF F02 F02 V V A A Run time error 713 class Manual Samsung Electronics Product spec and feature SEM F71 F71 SH: SH: V V 4A 4A F1 F1 V2C: V2C: V V 8A 8A V1 V1 :: V V 10A 10A CON1 CON1 (AC (AC POWER POWER CON.) CON.) F72 F72 V V 4A 4A CON4 CON4 (Main (Main PBA PBA CON.) CON.) 24V 24V :: 33 55 77 99 5V 5V :: 11 11 13 13 15 15 CON2 CON2 samsung scx-4828fn lsu hsync error (Heat Lamp Lamp CON.) CON.) F02 F02 V V A A PC51 PC51 TLPF TLPF (c) FUSER AC POWER CONTROL )XVHU+($7/$03JHWVKHDWIURP$&SRZHU7KH9$SRZHUFRQWUROVWKHVZLWFKZLWKWKH7ULDFD VHPLFRQGXFWRUVZLWFK7KHµ))FRQWURO¶LVRSHUDWHGZKHQWKHJDWHRIWKH7ULDFLVWXUQHGRQRIIE\ 3KRWRWULDFLQVXOWLQJSDUW,QRWKHUZRUGVWKH$&FRQWUROSDUWLVSDVVLYHFLUFXLWVRLWWXUQVWKHKHDWHURQRII ZLWKWDNLQJVLJQDOIURPHQJLQHFRQWUROSDUW :KHQWKHµ+($7(¶VLJQDOLVWXUQHGRQDWHQJLQHWKH/('RI3&3KRWR7ULDFWDNHVWKHYROWDJH DQGÀDVKHV)URPWKHÀDVKLQJOLJKWWKH7ULDFSDUWOLJKWUHFHLYLQJSDUWWDNHVWKHYROWDJHDQGWKHYROWDJHLV VXSSOLHGWRWKHJDWHRI7ULDFDQGÀRZVLQWRWKH7ULDF$VDUHVXOWWKH$&FXUUHQWÀRZVLQWKHKHDWODPSDQG KHDWLVRFFXUUHG2QWKHRWKHUKDQGZKHQWKHVLJQDOLVRIIWKH3&LVRIIWKHYROWDJHLVFXWRIIDWWKHJDWH RI7ULDFWKH7ULDFEHFRPHVRIIDQGWKHQWKHKHDWODPSLVWXUQHGRII ‡7ULDF4IHDWXUH$/9PRGHO$+9PRGHO,7&+,1* ‡3KRWRWULDF&RXSOHU3& Ƒ7XUQ2Q,I&XUUHQWP$aP$'HVLJQP$ Ƒ+LJK5HSHWLYH3HDN2II6WDWH9ROWDJH0LQ9 Service Manual Samsung Electronics Product spec and feature Fax ,PSOHPHQWHGE\EDVHGRQ&RQH[DQW'$$'DWD$FFHVV$UUDQJHPHQW6ROXWLRQDQGLVURXJKO\FRPSRVHGRI WZRNLQGV&KLS6ROXWLRQ &;6);([LVWLQJ0RGHP&KLSZKLFKDGGV66'6\VWHP6LGH'HYLFHIRULQWHUIDFLQJEHWZHHQ /6'DQG',%RI)03OXV&RUH &;/6'/,8/LQH,QWHUIDFH8QLW&KLSZKLFKLVFRQWUROOHGE\66'DQGVDWLV¿HVHDFK 5HTXLUHPHQWVE\PRGXODWLQJLQWHUQDO&RQ¿JXUDWLRQZLWKFRQQHFWLQJ7HO/LQH Service Manual Samsung Electronics Product spec and feature Scan 3LFWRULDOVLJQDOLQSXWSDUWRXWSXWVLJQDORI&,6SDVVHVWKURXJK03&DSFKDQJHWR$'&DW+79DQG GH¿QHGVLJQDOEHWZHHQ+79DQG&+SURFHVVHVWKH,PDJHVLJQDO:KHQ$)(DFFHSWHDFK SL[HO6+$6DPSOHDQG+ROG$PSOL¿HUWHFKQLTXHZKLFKVDPSOHVDUPOHYHORQFHLVXVHGRQHDFKSL[HOE\ &,6VLJQDO 3LFWRULDOLPDJHSURFHVVLQJSDUWUHDG&,63L[HOGDWDLQWHUPVRIGSL/LQHDQGSURFHVV(UURU'LIIXVLRQ $OJRULWKPWH[W0L[HGPRGHGLWKHUSKRWRPRGHDQGWKHQVWRUH'DWDDW6FDQ%XIIHURQ3&6FDQ PRGHZLWKRXWDOJRULWKP 2QHYHU\PRGH6KDGLQJ&RUUHFWLRQDQG*DPPD&RUUHFWLRQDUHH[HFXWHGDKHDGWKHQSURFHVVLQJLV H[HFXWHGODWHU 6FDQ,PDJH&RQWURO6SHFL¿FDWLRQ Η6FDQ/LQH7LPHPVHFFK Θ6FDQ5HVROXWLRQ0D['3, Ι6FDQ:LGWKPP Κ main function ,QWHUQDOELW$'& :KLWH6KDGLQJ&RUUHFWLRQ *DPPD&RUUHFWLRQ &,6,QWHUIDFH &,62SHUDWLQJ3DUW&,6,PDJHVHQVRUXVH9 &,60D[LPXP2SHUDWLQJ)UHTXHQF\0+] &,6/LQHWLPHPVHFFK :KLWH'DWDRXWSXW9ROWDJH9“90RQR&RS\PVOLQH Service Manual Samsung Electronics Product spec and feature Engine F/W (b) Driver \JHDULQJWKHPDLQPRWRUGULYHVWKHUROOHUVVXFKDVIHHGLQJUROOHUGHYHORSLQJUROOHUIXVHUUROOHUDQGH[LWLQJ % UROOHU7KH%/'&PRWRULVFRQWUROOHGIRUWKHVXFKDFFHOHUDWLRQVHFWLRQDQGVWHDG\VHFWLRQ 7KH%/'&PDLQPRWRULVRSHUDWHGE\WKH%/'&FORFNDQGWKHHQDEOHVLJQDO (c) Transfer 7KHFKDUJLQJYROWDJHGHYHORSLQJYROWDJHDQGWKHWUDQVIHUYROWDJHDUHFRQWUROOHGE\XOVH:LGWK 0RGXODWLRQ7KHHDFKRXWSXWYROWDJHLVFKDQJHDEOHGXHWRWKHGXW\7KHWUDQVIHUYROWDJHDGPLWWHG ZKHQWKHSDSHUSDVVHVWKHWUDQVIHUUROOHULVGHFLGHGE\HQYLURQPHQWUHFRJQLWLRQ7KHUHVLVWDQFHYDOXHRIWKH WUDQVIHUUROOHULVFKDQJHGGXHWRWKHVXUURXQGLQJHQYLURQPHQWRUWKHHQYLURQPHQWRIWKHVHWDQGWKHYROWDJH YDOXHZKLFKFKDQJHVGXHWRWKHHQYLURQPHQWVLVFKDQJHGWKURXJK$'FRQYHUWHU7KHYROWDJHYDOXHIRU LPSUHVVLQJWRWKHWUDQVIHUUROOHULVGHFLGHGE\WKHFKDQJHGYDOXH(DFKYROWDJHYDOXHLVFRQWUROOHGDFFRUGLQJ WR7LPLQJ&KDUW Service Manual Samsung Electronics Product spec and feature (d) Fusing 7KHWHPSHUDWXUHFKDQJHRIWKHKHDWUROOHUƒ‘VVXUIDFHLVFKDQJHGWRWKHUHVLVWDQFHYDOXHWKURXJKWKH WKHUPLVWRU %\FRQYHUWLQJWKHYROWDJHYDOXHZKLFKLPSUHVVHGWRWKHUHVLVWDQFHWRWKHGLJLWDOYDOXHWKURXJKWKH$' FRQYHUWHUWKHWHPSHUDWXUHLVGHFLGHG7KH$&SRZHULVFRQWUROOHUE\FRPSDULQJWKHWDUJHWWHPSHUDWXUHWR WKHYDOXHIURPWKHWKHUPLVWRU,IWKHYDOXHIURPWKHWKHUPLVWRULVRXWRIFRQWUROOLQJUDQJHZKLOHFRQWUROOLQJWKH IXVLQJWKHHUURUVWDWHGLQWKHEHORZWDEOHRFFXUV ‡/DPS0HWKRG Error Description 23(1+($7( :KHQZDUPLQJXSLWKDVEHHQORZHUWKDQRYHUVHFRQGV /2:+($7( 6WDQGE\KDVEHHQORZHUWKDQWKH6WDQGE\5HIHUHQFH7HPSHUDWXUHRYHU VHFRQGV 3ULQWLQJKDVEHHQORZHUWKDQWKH3ULQWLQJ5HIHUHQFH7HPSHUDWXUHRYHU VHFRQGV :KHQ:DUP8S(QG3URFHVVLWKDYHEHHQORZHUWKDQWKH:DUP8S5HIHUHQFH 7HPSHUDWXUHRYHUVHFRQGV 29(5+($7( ,WKDVEHHQKLJKHUWKDQRYHUVHFRQGV ,WKDVEHHQKLJKHUWKDQRYHUVHFRQGV ,WKDVEHHQKLJKHUWKDQWKH6WDQGE\5HIHUHQFH7HPSHUDWXUHRYHU VHFRQGV !7KLVFDQEHFKDQJHGLQWKHIXWXUH (e) LSU 7KH/68LVFRQVLVWHGRIWKH/'/DVHU'LRGHDQGWKHSRO\JRQPRWRUFRQWURO:KHQWKHSULQWLQJVLJQDO RFFXUVLWWXUQVRQWKH/'DQGGULYHVWKHSRO\JRQPRWRU:KHQWKHGHWHFWRUGHWHFWVWKHEHDP+V\QFRFFXUV :KHQWKHSRO\JRQPRWRUVSHHGEHFRPHVVWUDG\/UHDG\RFFXUV,IWZRFRQGLWLRQVDUHVDWLV¿HGWKHVWDWXVDUH QRWVDWLV¿HGWKHHUURUVKRZQLQEHORZRFFXUV Error Description Polygon Motor Error :KHQWKHSRO\JRQPRWRUVSHHGGRHVQWEHFRPHVWHDG\ +V\QF(UURU 7KHSRO\JRQPRWRUVSHHGLVVWHDG\EXWWKH+V\QFLVQRWJHQHUDWHG Service Manual Samsung Electronics Product spec and feature S/W Descriptions Overview 7KHVRIWZDUHRI6&;[VHULHVV\VWHPLVFRQVWUXFWHGZLWK +RVW6RIWZDUHSDUWWKDWWKHDSSOLFDWLRQVRIWZDUHRSHUDWHGLQ:LQGRZDQG:HE(QYLURQPHQWDQG )LUPZDUHSDUWVWKDWLVD(PEHGGHGVRIWZDUHFRQWUROVSULQWLQJMRE Architecture Host Software is made up of *UDSKLF8VHU,QWHUIDFHWKDWRIIHUVWKHYDULRXVHGLWLQJIXQFWLRQVWRXVHULQ+RVW 'ULYHUWKDWWUDQVODWHVWKHUHFHLYHGGRFXPHQWWRD3ULQWLQJ&RPPDQGODQJXDJHZKLFKSULQWHUFDQ XQGHUVWDQGDQGWUDQVIHUVGDWDWRVSRROHU 6WDQGDORQH$SSOLFDWLRQWKDWRIIHUVWKHYDULRXVSULQWLQJDSSOLFDWLRQULQWHU6HWWLQJV8WLOLW\3ULQWHU 6WDWXV0RQLWRU1HWZRUN0DQDJHPHQWLQ:LQGRZV\VWHP :HEEDVHG$SSOLFDWLRQWKDWRIIHUVWKHVDPHIXQFWLRQVDV6WDQGDORQH$SSOLFDWLRQDQG5'&5HPRWH 'LDJQRVLV&RQWUROLQ:HEHQYLURQPHQW Firmware is made up of $SSOLFDWLRQ(PXODWLRQWKDWLVDLQWHUSUHWHUWUDQVODWHGDWDUHFHLYHGIURP+RVWWRDSULQWLQJODQJXDJH3&/ 36*',RQO\6&;)1HWFWREHDEOHWRPDNHWKHXVHUWRWDNHVDPHRXWSXWDVRULJLQDOO\RQHZKDW FRPSRVHGLQ+RVW .HUQHOWKDWFRQWURODQGPDQDJHPHQWWKHZKROHSURFHGXUHLQFOXGHRI&RQWUROÀRZDQG3ULQWLQJ-REEHIRUH WUDQVIHUWR(QJLQHV\VWHP Service Manual Samsung Electronics Product spec and feature Data and Control Flow *',RQO\6&;)1 3&/3&/;/ The above Block Diagram is explained that: Host Side is made up of 'ULYHUWKDWLV:LQGRZVDSSOLFDWLRQVRIWZDUHWUDQVODWHSULQWHGGDWDWRRQHRISULQWHUODQJXDJHDQGFUHDWH VSRROHU¿OH :HEEDVHG$SSOLFDWLRQWKDWRIIHUDYDULRXVSULQWHUDGGLWLRQDOIXQFWLRQVPDQDJHPHQWRISULQWLQJMRE SULQWHUDGPLQLVWUDWLRQ6WDWXVPRQLWRUWRPRQLWRULQJWKHSULQWHUVWDWXVE\UHDOWLPHLQ:HELQGHSHQGHQW HQYLURQPHQWRQ26 6WDQGDORQH$SSOLFDWLRQWKDWLVDVLPLODU:LQGRZVRIWZDUHDVVDPHDVDERYH 3RUW0RQLWRUWKDWPDQDJHVWKHQHWZRUNFRPPXQLFDWLRQEHWZHHQVSRROHUDQG1HWZRUN,QWHUIDFH&DUGRU YDULRXVDGGLWLRQDODSSOLFDWLRQDQG1HWZRUN,QWHUIDFH&DUGWKLVLVDW¿UVWPDNHFRPPXQLFDWLRQORJLFDO SRUWPDQDJHWKHGDWDWUDQVIHUWKHPIURPVSRROHUWRQHWZRUNSRUWDQGRIIHUWKHUHVXOWRISULQWLQJ Service Manual Samsung Electronics Product spec and feature Firmware Side is made up of 1HWZRUN,QWHUIDFH&DUGLVWKDWUHOD\WKHFRPPXQLFDWLRQEHWZHHQ+RVWDQGNHUQHOXVLQJYDULRXVQHWZRUN SURWRFRO .HUQHOLVWKDWPDQDJHVWKHÀRZFRQWURORIHPXODWLRQSURFHGXUHUHFHLYLQJGDWDIURP+RVWRU1HWZRUNFDUG DQGSULQWLQJZLWKHQJLQHUHQGHULQJMRE (PXODWLRQLVWKDWLQWHUSUHWVWKHYDULRXVRXWSXWGDWDIURPVHOHFWHGHPXODWLRQ (QJLQHLVWKDWSULQWVUHQGHUHGELWPDSGDWDWRSDSHUZLWKUHTXLUHGVL]HDQGW\SHE\.HUQHO $QGWKHQIRU-RE6SRROLQJIXQFWLRQIRU0XOWL8VHU0XOWL3ULQWLQJWKDWLVRFFXUUHGLQ1HWZRUNSULQWLQJDQG sprers.euVHPD[4XHXLQJV\VWHPVLQDPHPRU\ In Printing, the two procedures are &DVHRIXVLQJ86%3RUW $IWHUXVHUVWDUWWRSULQWWKHZDQWHGGRFXPHQWWR3&/VWULQJRUFRPSUHVVHG*',ELWPDSGDWD'ULYHU WUDQVODWHWKHDOOJUDSKLFGDWDRILWDQGVHQGGDWDWRKRVWVSRROHU$QGWKHQWKHVSRROHUVHQGVWKHGDWD VWUHDPWRWKHSULQWHUYLD86%SRUW .HUQHOUHFHLYHVWKLVGDWDIURP+RVWDQGWKHQVHOHFWHPXODWLRQ¿WWRGDWDDQGVWDUWVHOHFWHGRQH$IWHU sprers.euHQGVWKHRXWSXWELWPDSGDWDWR(QJLQHXVLQJ3ULQWHU9LGHR&RQWUROOHUE\ FORFNW\SHIRU/68 (QJLQHSULQWWKHUHFHLYHGGDWDWRUHTXLUHGSDSHUZLWKWKHVHTXHQWLDOGHYHORSLQJSURFHVV &DVHRIXVLQJ1HWZRUN,QWHUIDFH&DUG $IWHUXVHUVWDUWWRSULQWWKHZDQWHGGRFXPHQWWR3&/VWULQJRUFRPSUHVVHG*',ELWPDSGDWD'ULYHU WUDQVODWHWKHDOOJUDSKLFGDWDRILWDQGVHQGGDWDWRKRVWVSRROHU ,IVR3RUWPRQLWRUPDQDJLQJQHWZRUNSRUWUHFHLYHVGDWDIURPVSRROHUDQGVHQGVDGDWDVWUHDPWRWKH 1HWZRUN,QWHUIDFH&DUG sprers.euDUW .HUQHOUHFHLYHVWKLVGDWDIURP+RVWDQGWKHQVHOHFWHPXODWLRQ¿WWRGDWDDQGVWDUWVHOHFWHGRQH$IWHU sprers.euHQGVWKHRXWSXWELWPDSGDWDWR(QJLQHXVLQJ3ULQWHU9LGHR&RQWUROOHUE\ FORFNW\SHIRU/68 (QJLQHSULQWWKHUHFHLYHGGDWDWRUHTXLUHGSDSHUZLWKWKHVHTXHQWLDOGHYHORSLQJSURFHVV The additional printing function are realized in :HEHQYLURQPHQW :LQGRZHQYLURQPHQW sprers.euQIRUPVDVWDWXVRISULQWLQJVWDWXVDQGSULQWHUVWDWXVWRXVHUPDGHSULQWLQJMREZLWKWKH 6WDWXV0RQLWRU Service Manual Samsung Electronics Disassembly and Reassembly 3. Disassembly and Reassembly General Precautions on Disassembly Releasing Plastic Latches When you disassemble and reassemble components, you must use extreme caution. The close proximity of cables to moving parts makes proper routing a must. If components are removed, any cables disturbed by the procedure must be restored as close as possible to their original positions. Before removing any component from the machine, note the cable routing that will be affected. Many of the parts are held in place with plastic latches. The latches break easily; release them carefully. To remove such parts, press the hook end of the latch away from the part to which it is latched, samsung scx-4828fn lsu hsync error. Whenever servicing the machine, you must perform as follows: 1. Check to verify that documents are not stored in memory. 2. Be sure to remove the toner cartridge before you disassemble parts. 3. Unplug the power cord. 4. Use a flat and clean surface. 5. Replace only with authorized components. 6. Do not force plastic-material components. 7. Make sure all components are in their proper position. Service Manual Samsung Electronics Disassembly and Reassembly General Disassembly Front Cover 1. Open the front cover after take out the cassette. 2. Separate the front cover from the lock the frame by pulling the front cover to the direction of arrow. Rear Cover 1. Remove the Duplex unit. Service Manual 2. Open the rear cover. And separate the rear cover from the locking by pulling the rear cover to the direction of arrow. Samsung Electronics Disassembly and Reassembly Right/Left Cover 1. Remove the one screw. And pull and release the right cover somewhat. 3. Pull the left cover to the direction of arrow and release it. 2. Release the right cover after unplug the 1 connector from Main PBA. Service Manual Samsung Electronics Disassembly and Reassembly Scan and ADF Assy 1. Remove the 2 screws after remove the right cover. 2, samsung scx-4828fn lsu hsync error. Remove the one screw and connected harness from Main board. And lift the Scan Assy to the direction of arrow. ADF Unit 1. Unplug the harness after remove the cap harness as shown below. Service Manual 2. Lift up and release the ADF Assy. Samsung Electronics Disassembly and Reassembly Stacker TX 1. Remove the 2 screws from the bottom of ADF Assy. Service Manual 2. Lift up and release the Stacker TX Samsung Electronics Disassembly and Reassembly ADF Engine unit 1. Open the ADF cover and remove it, samsung scx-4828fn lsu hsync error. And remove the pick-up roller by following below sequence. 2 3 1 Locking 2. Remove the ADF engine unit after remove the 2 screws from the bottom of SET. Service Manual 3. Remove the 2 screws of the ADF cover upper. And then lift it up. Samsung Electronics Disassembly and Reassembly OPE Unit 1. Pull up the OPE unit. 2. Remove the 2 connector and release the OPE unit. Hook CIS Unit 1. Remove the 4 screws of the Scan upper. Service Manual 2. Remove the 4 screw and 1 CIS cable. And release the CIS unit. Samsung Electronics Disassembly and Reassembly Middle Cover 1. Remove the 2 screws as shown below. 2. Remove the 2 screws from the front and rear of the SET. Unplug the harness connected to the main board. And lift the middle cover up. Fuser 1. Remove the rear cover. Remove the Guide rear by pushing both side and removing the hinge. 2. Remove the 4 screw. And remove the fuser after remove the connector. CAUTION The fuser is very hot. So turn the printer off and wait until the printer to cool before replacing it. Service Manual Samsung Electronics Disassembly and Reassembly LSU 1. Release the LSU after remove the 4 screws and one connector. Main Getlasterror = 299 Assy - Before disassembly, remove the cassette, Cover front, Cover left, Cover rear. 1. Remove the rear cover. Remove the Guide rear by pushing both side and removing the hinge. Service Manual 2. Remove the 4 screw. And remove the fuser after remove the connector. Samsung Electronics Disassembly and Reassembly HVPS/SMPS/Main board - Before disassembly, remove the cover front, cover rear, cover rigth. 1. Release the HVPS board after remove the 6 screws and 1 connector. 2. Release the SMPS board after remove the 4 screws and 2 connector. Service Manual 3. Release the Main board after samsung scx-4828fn lsu hsync error the 4 screws and all harness. Samsung Electronics Disassembly and Reassembly Transfer roller 1. Push HOLDER-TRANSFER, which holds the transfer roller and remove the roller from set. Caution - Be carefull not to touch the sponge of Transfer Roller. Service Manual Samsung Electronics Disassembly and Reassembly Holder Pad unit 1. Remove the CASSETTE from SET. Service Manual 2. Disassemble HOLER-PAD after putting out three HOOKs Samsung Electronics Alignment & Troubleshooting 4. Alignment & Troubleshooting This chapter describes the main functions for service, such as the product maintenance method, the test samsung scx-4828fn lsu hsync error related to maintenance and repair, DCU using method, Jam removing method, and so on. It includes the contents of manual. Alignment and Adjustments Control Panel overview 1 ID Copy You can copy both sides of the ID Card like a driver’s license to a single side of paper. 2 Direct USB Allows you to directly print files stored on a USB Memory device when it is inserted into the USB memory port on the front of your machine. (SCX-4x28 Series only) Reduce/Enlarge Makes a copy smaller or larger than the original. (SCX-4x24 Series only) 3 Display Shows the current status and prompts during an operation. 4 Status Shows the status of your machine. 5 Fax Activates Fax mode. 6 Copy Activates Copy mode. 7 Scan/Email Activates Scan mode. 8 Menu Enters Menu mode and scrolls through the available menus. 9 Left/right arrow Scroll through the options available in the selected menu, and increase or decrease values. 10 OK Confirms the selection on the screen. 11 Back Sends you back to the upper menu level. 12 Number keypad Dials a number or enters alphanumeric characters. 13 Address Book Allows you to store frequently used fax numbers in memory or search for stored fax numbers or email addresses. 14 Redial/Pause In ready mode, redials the last number, or in Edit mode, inserts a pause into a fax number. 15 On Hook Dial Engages the telephone line. 16 Stop/Clear Stops an operation at any time. In ready mode, samsung scx-4828fn lsu hsync error, clears/cancels the copy options, such as the darkness, the document type setting, the copy size, and the number of copies. 17 Start Starts a job. Service Manual Samsung Electronics Alignment & Troubleshooting Understanding The Status LED The color of the Status LED indicates the machine’s current status. Status Description Off ‡7KHPDFKLQHLVSRZHUHGRIIOLQH ‡7KHPDFKLQHLVLQSRZHUVDYHPRGH:KHQGDWDLVUHFHLYHGRUDQ\ button is pressed, it switches to on-line automatically. Green Red Service Manual On ‡7KHPDFKLQHLVSRZHUHGRQDQGFDQEHXVHG Blinking ‡:KHQWKHJUHHQ/('VORZO\EOLQNVWKHPDFKLQHLVUHFHLYLQJGDWDIURP the computer. ‡:KHQWKHJUHHQ/('UDSLGO\EOLQNVWKHPDFKLQHLVSULQWLQJGDWD On ‡$SUREOHPKDVRFFXUUHGVXFKDVDSDSHUMDPFRYHURSHQRUQRSDSHULQ the tray, so that the machine cannot continue the job. ‡7KHWRQHUFDUWULGJHLVHPSW\RUQHHGVWREHFKDQJHG Blinking ‡$PLQRUHUURUKDVRFFXUUHGDQGWKHPDFKLQHLVZDLWLQJIRUWKHHUURUWREH cleared, samsung scx-4828fn lsu hsync error. ‡7KHWRQHUFDUWULGJHLVORZ2UGHUDQHZWRQHUFDUWULGJH Samsung Electronics Alignment & Troubleshooting Paper path Scanner Part PICK-UP52//(5 $')52//(5 COVER OPEN ADF-UPPER )(('52//(5 EXIT 52//(5 $')/2:(5 SCAN UPPER $')*/$66 :+,7(%$5 Engine Part LSU DEVE FUSER DUPLEX CASSETTE Service Manual Samsung Electronics Alignment & Troubleshooting Clearing Document Jams :KHQDQRULJLQDOMDPVZKLOHSDVVLQJWKURXJKWKH$')'RFXPHQW-DPDSSHDUVRQWKHGLVSOD\ Input Misfeed 4. Align the left end of the ADF roller with the slot and push the right end of the ADF roller into the right slot (1). Rotate the bushing on the right end of the roller toward the document input tray (2). 1. Remove any remaining pages from the ADF. 2. Open the ADF cover, samsung scx-4828fn lsu hsync error. 1 ADF cover 5. Close the ADF cover. Then load samsung scx-4828fn lsu hsync error removed page(s), if any, back into the ADF. 3. Rotate the bushing on the right end of the ADF roller toward the ADF (1) and remove the roller from the slot (2). Pull the document gently to the left and out of the ADF. Service Manual Samsung Electronics Alignment & Troubleshooting Exit misfeed Roller misfeed 1. Remove any remaining pages from the ADF. 1. Open the scanner lid. 2. Seize the misfeed paper, and remove the paper from the document output tray by carefully pulling it to the right using both hands. 2. Seize the misfeed paper, and remove the paper from the feed area by carefully pulling it to the right using both hands. /RDGWKHUHPRYHGSDJHVEDFNLQWRWKH$') 3. Close the scanner lid. Then load the removed pages back into the ADF. Service Manual Samsung Electronics Alignment & Troubleshooting Clearing paper jams :KHQDSDSHUMDPRFFXUVWKHZDUQLQJPHVVDJHDSSHDUVRQWKHGLVSOD\VFUHHQ5HIHUWRWKHWDEOHEHORZWR locate and clear the paper jam. Message Location of jam Paper Jam 0 Open/Close Door In the paper feed area or inside the machine Paper Jam 1 Open/Close Door Inside the machine Paper Jam 2 Check Inside Inside the machine or in the fuser area Duplex Jam 0 Check Inside Inside the machine Duplex Jam 1 Open/Close Door In the paper feed area or inside the machine In the paper feed area 2. Remove the jammed paper by gently pulling it straight out as shown below. If paper is jammed in the paper feed area, follow the next steps to release the jammed paper. 1. Pull the tray open. If the paper does not move when you pull, or if you do not see the paper in this area, check In the toner cartridge area. 3. Insert the tray back into the machine. Printing automatically resumes. Service Manual Samsung Electronics Alignment & Troubleshooting In the manual tray In the toner cartridge area :KHQ\RXSULQWXVLQJWKHPDQXDOWUD\DQGWKH machine detects that there is either no paper or that the paper has been improperly loaded, follow the next steps to release the jammed paper. If paper is jammed in the toner cartridge area, follow the next steps to release the jammed paper. 1. Open samsung scx-4828fn lsu hsync error front cover and pull the toner cartridge out 1. Check if the paper is stuck in the feeding area, and if so, pull it samsung scx-4828fn lsu hsync error gently and slowly. /RDGDSDSHULQWRWKHPDQXDOWUD\ 2. Remove the jammed paper by gently pulling it straight out as shown below. 3. Open the front cover and close it, samsung scx-4828fn lsu hsync error. The machine will resume printing. 3. Replace the toner cartridge and close the front cover. Printing automatically resumes. Service Manual Samsung Electronics Alignment & Troubleshooting In the paper exit area In the duplex unit area If paper is jammed in the paper exit area, follow the next steps to release the jammed paper. If the duplex unit is not inserted correctly, paper jam may occur. Make sure that the duplex unit is inserted correctly. 1. If a long portion of the paper is visible, pull it straight out. Open and close the front cover ¿UPO\7KHPDFKLQHZLOOUHVXPHSULQWLQJ 1. Pull the duplex unit out of the machine, samsung scx-4828fn lsu hsync error. ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 2. 2. Remove the jammed paper from the duplex unit. 2. Open the rear cover. 3. Pull the guide rear on each side down and carefully take the jammed paper out of the machine. Return the guide rear to its original position. If the paper does not come out with the duplex unit, remove the paper from the bottom of the machine. 1 Guide rear 4. Close the rear cover. Printing automatically resumes. Service Manual ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 3. Samsung Electronics Alignment & Troubleshooting 2. If you see the jammed paper, remove the paper from the machine by gently pulling it straight out as shown below. 3. Open the rear cover. 4. Pull the guide rear on each side down and remove the paper, samsung scx-4828fn lsu hsync error. Return the guide rear to its original position. ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 3. 3. Pull the tray half. 1 Guide rear 5. Close the rear cover. Printing automatically resumes. In the optional tray Samsung scx-4828fn lsu hsync error paper is jammed in the optional Tray, follow the next steps to release the jammed paper. 1. Pull the optional tray open. 4. Remove the jammed paper by gently pulling the paper straight up and out. 5. Insert the trays back into the machine. Printing automatically resumes. Service Manual Samsung Electronics Service Manual Darkness Resolution Multi Send Delay Send Prio rity Se nd Forw ard Secur e Receive Add Page Cancel Job Fax Feature Sending Redial Tim es Redial Term Prefix Dial ECM Mode Send Report Image TCR Dial Mode Receiv ing Receiv e Mode Rin g to An swer Fax Samsung scx-4828fn lsu hsync error Fax Setup (Continued) Stamp Rcv Name Rcv Start Code Auto Re duction Discard Size Ju nk Fax Set up DRPD Mode Dupl ex Pri nt Change D efaul t Resoluti on Dark ness Auto Re portsamsung scx-4828fn lsu hsync error. TCP/IP Ethern et Spe ed Clear Settin g Network I nfo Network Reduce/Enlar ge Darkness Origina l Type /D\ out Norm al 2-Up 4-Up ID Copy Pos ter Cop y Samsung scx-4828fn lsu hsync error e Cop y Adjus t Bk gd. Copy Feature Clear Settin g All S etting samsung scx-4828fn lsu hsync error Fax Setup Copy Setu p Scan Setup Sys tem Setup Network Addre ss B ook Sent Report Fax Rcv Repo rt System Setup (Continued) Duple x Change Default Copie s Copy Colla tion Redu ce/Enlar ge Darkness Origina l Type Copy Setup Report All Report Configura tion Supplie s Info Address Book Send Report Sent Report Fax Rcv Repor t Schedule Jobs Junk Fax Report Netw ork Info. User Auth /LV t Main tenance &/R Empty Msg Ignore Tone r Supplie V/ ife Serial N umbe r System Setup (Continued) USB Feature Scan Size Origina l Type Resolutio n Scan Colo r Scan Form at E-mail Fe ature Scan Size Origina l Type Resolutio n Scan Colo r Scan Form at Scan Feature Mach ine Setup Mach ine ID Mach ine Fax No, samsung scx-4828fn lsu hsync error. Date & Time Clock Mod e /Dngu age Default Mode Power Sav e Timeout Job Timeout Alt itude Adj. Import Setting Export Se tting Paper Setup Paper Si ze Paper Type Paper So urce Sound/Vo lum e Key Sou nd Ala rm Sound Speaker Ringer System Setup Change Default USB Default E-mail Defa ult Scan Setup Alignment & Troubleshooting Menu Map The control panel provides access to various menus to set up the machine or use the machine’s functions. These menus can be accessed by pressing Menu. Refer to the following diagram. Menus available in Fax, Copy, or Scan mode vary. Samsung Electronics Alignment & Troubleshooting Accessing to menus The next steps are the example to print the menu map of this machine, and they are the general way to VHOHFWPHQXDQGFRQ¿JXUH\RXUPDFKLQH 1. Make sure your machine is properly connected all the necessary cables, and turn on the machine. 2. Press the Menu button until you see the menu (ex. Information) you want on the bottom line of the display. 3. Press the OK button to access the menu. 3UHVVWKH/HIWULJKWDUURZEXWWRQVXQWLOWKHPHQXLWHPH[0HQX0DS\RXZDQWGLVSOD\VRQWKHERWWRP line. sprers.euWRFRQ¿UPWKHVHOHFWHGLWHP 3UHVVWKH/HIWULJKWDUURZEXWWRQVXQWLOWKHPHQXLWHPH[3ULQW"\RXZDQWGLVSOD\VRQWKHERWWRPOLQH 7. Press the OK button to process your selection, save your input or selection. An asterisk (*) appears next to the selection on the display, indicating that it is now the default. 8. To exit the menu, press the Back button repeatedly, or the Stop button. Note - If you want to set the basic menu items, please consult the user guide. Service Manual Samsung Electronics Alignment & Troubleshooting Tech Mode How to Enter Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction. :KLOHLQ7HFKPRGHWKHPDFKLQHVWLOOSHUIRUPVDOOQRUPDORSHUDWLRQV To enter the Tech mode To enter the Tech mode, press LQVHTXHQFHDQGWKH/&'EULHÀ\ GLVSOD\Vµ7(&+¶WKHPDFKLQHKDVHQWHUHGVHUYLFHWHFKPRGH Setting-up System in Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction. SCXFN/FN 6HQG/HYHO '70)/HYHO Pause Time Dial Mode Modem Speed Error Rate RDS Clear All Mem Clear Counts Flash Upgrade Silence Time Service Manual Switch Test Modem Test Dram Test Rom Test Pattern Test Shading Test All Report Protocol Configuration .H\+LVWRU\ Error Info Usage Page Component Check Service Support Samsung Electronics Alignment & Troubleshooting Data Setup SEND LEVEL You can set the level of the transmission signal. Typically, the Tx level should be under dBm. &DXWLRQ7KH6HQG)D[/HYHOLVVHWDWWKHEHVWFRQGLWLRQLQWKHVKLSPHQWIURPIDFWRU\1HYHUFKDQJHVHWWLQJV arbitrarily. DIAL MODE This function can choose dial method. *Default : Dial(Dial/Pulse) MODEM SPEED You can set the maximum modem speed. Communication is done with modem speed automatically set at lower speed when communicating with a slower speed modem since communication is done on the standard of the side where modem speed is low for transmission/reception. It is best set Kbps as default setting. ERROR Samsung scx-4828fn lsu hsync error :KHQWKHHUURUUDWHLVDERXWH[FHHGWKHVHWYDOXHWKH%DXGUDWHDXWRPDWLFDOO\DGMXVWVWRESV This ensures that the error rate remains below the set value. You can select the rate between 5% samsung scx-4828fn lsu hsync error 10%. CLEAR ALL MEMORY The function resets the system to factory default settings. This function is used to reset the system to the initial value when the product is functioning abnormally. All the values are returned to the default values, and all the information, samsung scx-4828fn lsu hsync error, which was set by the user, will be erased. < Method > 6HOHFWWKH>0(<&/([email&#;protected](&+02'( 2. Push the OK button. 3. Select you country. (There are four country groups. Refer to the table below.) 4. Push the OK button then it will clear all memory. NOTICE : Always perform a memory clear after replacing the main board. Otherwise, the system may not operate properly. Country Group USA/Canada USA/Canada Mexico Brazil Country Service Manual UK UK Germany France Italy Spain Austria Netherlands Belgium Portugal Sweden Norway Denmark Finland Switzerland Greece Ireland Turkey Russia Russia India Oman Poland Bangladesh Kuwait Moroco Algeria Pakistan UAE Bahrain Srilanka Saudi Arabia Chile Peru Argentina +XQJDU\ Romania Bulgaria Czech Southafrica South Africa Samsung Electronics Alignment & Troubleshooting Flash Upgrade 7KH)LUPZDUH8SJUDGHIXQFWLRQDQGKDVWZRPHWKRGV/RFDODQG5HPRWH 1) Local Machine Upgrade ‡5&35HPRWH&RQWURO3DQHOPRGH This method is for USB Port Connect to PC and activate RCP(Remote Control Panel) to upgrade the Firmware. < Method > +RZWR8SGDWH)LUPZDUHXVLQJ5&3 1. Connect PC and Printer with USB Cable. 2. Execute RCP and select Firmware Update. 6HDUFK)LUPZDUH¿OHWRXSGDWHZLWK%URZVH,FRQ &OLFN8SGDWHLFRQ¿UPZDUH¿OHLVWUDQVPLWWHGWR3ULQWHUDXWRPDWLFDOO\DQGSULQWHULVLQLWLDOL]HGZKHQLW ¿QLVKHG 5. Click Refresh icon and check what is updated. ‡'26&RPPDQGPRGH This method is just for USB Port, samsung scx-4828fn lsu hsync error. Connect to PC with USB cable and enter DOS Command to upgrade the Firmware < Method > 7KH¿UVWRIDOOQHHGWKH¿OHVGRZQEDWGRZQBFRPELQISUWH[HDQG5RP)LOH¿OHQDPHIRUXSJUDGH 6DYHWKH¿OHVLQWKHVDPHIROGHU 2. In the DOS, input as below and push the enter key. Then, it will be automatically upgraded. 3. There are two commands for the conditions of product. :KHQWKHSURGXFWLVLQLGOHFRQGLWLRQGRZQ³URP¿OH´ :KHQWKHSURGXFWLVLQ5HDG\FRQGLWLRQ7(&+02'('$7$6()/$6+83*5$'(/2&$/FRS\E ³URP¿OH´OSW 4. Do not turn off the power while upgrading process. 2) Remote Upgrade 7KLVLVDIXQFWLRQWKDWDID[ZLWKWKHODWHVW¿UPZDUHVHQGV¿OHVWRDID[LQORQJGLVWDQFHWKURXJKWHOHSKRQH line. < Method > %HIRUHUHPRWHXSJUDGHWKHODWHVW¿UPZDUHVKRXOGEHORDGHGLQWRWKHPDFKLQH 7(&+02'('$7$6()/$6+83*5$'(5(( 2. Input the fax number, which needs to be upgraded. (Several faxes can be upgraded at the same time. In this case, enter the each fax number.) $IWHUSXVKWKHHQWHUEXWWRQVHQGWKH¿UPZDUH¿OHE\FDOOLQJWRWKHDSSRLQWHGQXPEHU$URXQGa PLQXWHVQHHGVWRVHQGWKH¿OH < Caution > 1. sending and receiving fax must be the same model. 2, samsung scx-4828fn lsu hsync error. A sending fax must be set up as ECM mode, and a receiving memory must be set up as %. If not, the function operates abnormally Service Manual Samsung Electronics Alignment & Troubleshooting S/W of Maintenance 1, samsung scx-4828fn lsu hsync error. Clearing the Memory ‡<RXFDQVHOHFWLYHO\FOHDULQIRUPDWLRQVWRUHGLQ\RXUPDFKLQHVPHPRU\ 1) Press Menu on the control panel until Maintenance appears on the top samsung scx-4828fn lsu hsync error of the display. 2) Press the scroll button (left-key or right-key) until you see Clear Memory on the bottom line and press OK 7KH¿UVWDYDLODEOHPHQXLWHP&OHDU$OO0HPGLVSOD\VRQWKHERWWRPOLQH 6HHQH[WSDJH7KHUHDUHVRPHLWHPWRGLVSOD\RQWKH/&' 3) Press the scroll button (left-key or right-key) until you see the item you want to clear. 4) Press Enter. The selected memory is cleared and the display asks you to continue clearing the next item. 5) To clear another item, press Enter and repeat steps 3 and 4 - To return to Standby mode, press Stop/Clear. - As below item you can selectively clear information stored in your machine s memory. ‡&OHDU$OO0HP - Clears all of the data stored in the memory and resets all of your settings to the factory default. ‡3DSHU6HWWLQJ - Restores all of the Paper Setting options to the factory default. ‡&RS\6HWXS - Restores all of the Copy Setup options to the factory default. ‡)D[6HWXS - Restores all of the Fax Setup options to the factory default. ‡)D[)HDWXUH - Cancels all of the scheduled fax jobs in the machine s memory. - As below item you can selectively clear information stored in your machine s memory. ‡$GYDQFHG)D[ - Restores all of the Advanced Fax setting options to the factory default. ‡6RXQG9ROXPH - Resets the sound and volume settings to the factory default. ‡0DFKLQH6HWXS - Resets all of the system settings, such as the machine ID, date and time, display language and save modes, to the factory default. ‡6HQW5HSRUW - Clears all of records of your faxes sent. ‡5&95HSRUW - Clears all of records of your faxes received. ‡3KRQH%RRN - Clears the one-touch, speed and group dial numbers stored in the memory. 2. Adjust shading ‡:KHQWKHVFDQXQLWEHFRPHVGLUW\LWFDQDOWHUWKHVKDGLQJYDOXH ‡,I\RXUFRS\KDVEODFNOLQHVRULVEOXUUHGDGMXVWWKHVKDGLQJVHWWLQJ /RDGDVKHHWRIZKLWHSDSHULQWRWKH$') 2) Make machine Tech mode. 3) Press Menu on the control panel and scroll until Machine Test displays. 4) Scroll to Shading Test and Press OK. 5) Select Shading&Print appears on the bottom line and press OK. 6) Your machine picks up the paper and adjusts the shading value. 7) After adjusting, shading value will be printed with graphic image. Service Manual Samsung Electronics Alignment & Troubleshooting 3. Remote Diagnostic System(RDS) ‡5'6DQG)7(*7$XWRPDWLF2UGHULQJ6\VWHPZLOOHQKDQFHWKHTXDOLW\DQGWKHVSHHGRIDIWHUVDOHV service and monitor the performance of the MFP at the customer site. ‡0)36KRXOGEHFRQQHFWHGE\0)36HUYHU Required components of RDS RDS for MFP system consists of the following three components that communicate with each other 1. Main RDS Server connected to FAX-MODEM. 2. RDS Client Application. 3. RDS on MFP. Enable of RDS on MFP This value is in Tech Mode. The factory default for Consumables Status Update / Error Proactive value is Disabled, samsung scx-4828fn lsu hsync error. < Method > 1. MFP Should be connected by RDS Server. 2. Service numbers should have the proper values. 7(&+02'(!'$7$6(!,)<(5!5'6!6HUYLFH1XPEHU 3. Machine Serial No. should have the proper values. 7(&+02'(!'$7$6(!,)<(5!7RQHU!6HULDO1R 4. Criter value input is optional, default is set to page. 7(&+02'(!'$7$6(!,)<(5!5'6!&ULWHU9DOXH 5, samsung scx-4828fn lsu hsync error. Remote Test should be On 0DLQWHQDQFH!5HPRWH!7HVW2Q 6. Change the password : if you forgot the Notify Toner password, enter the new password. 7(&+02'(!'$7$6(!,)<(5!5'6!5'63DVVZRUG ,I\RXDUHWRHQDEOHWKH5'6V\VWHP1RWLI\7RQHURSWLRQVKRXOGEH>[email&#;protected]

    List of  Samsung ML &#; nd / nd Error Codes  

    Below you will find the Samsung ML &#; nd / nd Error Codes along with a few tips on working through these problems. Unfortunately the service manual doesn&#;t have an illustrated picture showing the different sensor locations in this machine but I will supply a picture of the feed path which should help in some troubleshooting information.

    Samsung ML - nd - nd Error Codes List&#;

    &#;

    &#;

    &#;

    &#;

    &#;

     

    Door Open &#; Close the top cover. Verify the actuator and sensor are properly seated and functioning right.
    Duplex Jam 0 &#; Paper made it to the exit sensor but failed to duplex sensor. Remove jam and check for debris in the area.
    Duplex Jam 1 &#; Paper made it to the duplex sensor but failed to make it back to the feed sensor.
    Fuser Door Open &#; check the back door. Make sure the sensor and actuator are working properly
    Install Toner &#; verify correct toner is installed, check contacts, replace with OEM toner
    Invalid Toner &#;  verify correct toner is installed, check contacts, replace with OEM toner
    Load Manual Press Stop Key &#; The machine has been selected to print in manual feed mode. check your settings. Load manual tray with correct size and type of paper
    Low Heat Error &#; The temperature of the fuser is below operating level. Turn off then back on. Replace the fuser.
    LSU Hsync Error &#; The laser motor got up to speed but experienced other problems. Turn off then back on. Replace LSU
    LSU Motor Error &#; laser scanner motor did not get to operating speed and or steady speed. Turn off then back on. Replace LSU
    Main Motor Locked &#; Fuser rollers will melt together and cause this issue or toner cartridges will have the same effect. Replace defective part.
    Open Heat Error &#; No AC through Fuser. Check thermostats and lamp inside fuser. Replace Fuser if needed.
    Over Heat Error &#; Over heat condition in the fusing unit. Turn off and let the machine sit 15 to 30 minutes then try again. Test the fan.

    Paper Jam 0 &#;  Paper failed to make it to the feed sensor. Check paper tray, feed path, and roller. Clean pick up roller or replace
    Paper Jam 1 &#;  Paper made it to the feed roller but failed to make it to the exit senor. Open cover, remove toner, and remove paper, look for debris in path. Verify the fusing assembly is working and the exit sensor is in place.
    Paper Jam 2 &#;  Paper made it to the exit samsung scx-4828fn lsu hsync error but failed to get out of it in time.
    Printing&#; &#; If this message will not go away. Unplug communication cable and turn off then on.
    Ready &#; The printer is ready to print. If will not go away try printing an internal test print and check communication cables and settings.
    Replace Toner &#; toner at the end of it&#;s life. Replace with new OEM toner
    Self Diagnostic&#;  &#; Something is wrong. Typically this leads to a fuser problem. Check fuser. Sometimes if you wait long enough it will give you the code, or press the cancel button. Other times turning it off then back on could lead to the actual error.
    Sleeping&#; &#; Power Save mode. Turn off then back on if it will not clear. Check communication cables. USB cables should be 6 foot or less.
    Toner Low &#; Early warning message. Order in New OEM toner
    Tray 1 Paper Empty &#;  Check to make sure the tray is working and paper is loaded properly.
    Tray 2 Paper Empty &#;  Check to make sure the tray is working and paper is loaded properly.

    1 DIGITAL LASER MFP Model samsung scx-4828fn lsu hsync error SCXFN/XAZ Basic : SCXFN/SCXFN The keynote of Product - Print/Copy Speed SCXFN : 24 ppm (A4) / 24 cpm (A4) SCXFN : 28 ppm (A4) / 28 cpm (A4) - Print resolrution : dpi effective output - CPU : Mhz - PCL5e, PCL6, IBM ProPrinter, EPSON PS(FN) - Memory SCXFN : 64MB(Max. MB) SCXFN : MB(Max. MB) - ADF : 30(FN) / 50(FN) Sheet - MP : 1 Sheet - Toner : 2K(Initial)/ 5K(Sales)

    2 Contents chapter 1 Precautions Safety Warning Caution for safety ESD Precautions Super Capacitor or Lithium Battery Precautions chapter 2 Product spec and feature Product Overview Model Comparison Summary of Product Printer Components System Layout S/W Descriptions chapter 3 Disassembly and Reassembly Disassembly and Reassemblyons on Disassembly Screws used in the printer General Disassembly Front Cover Rear Cover Right/Left Cover Scan and ADF Assy Samsung scx-4828fn lsu hsync error Cover Fuser LSU Main Drive Assy HVPS/SMPS/Main board

    3 Contents Transfer roller Holder Pad unit chapter 4 Alignment & Troubleshooting Alignment and Adjustments Control Panel overview Understanding The Status LED Paper path Menu Map Tech Mode EDC Mode Abnormal Image Printing and Defective Roller Error Message Troubleshooting Procedure of Checking the Symptoms The cause and solution of Bad image The cause and solution of the bad discharge The cause and solution of the malfunction The cause and solutions of bad environment of the software Fax & Phone Problems Copy Perl no child processes error Scanning Problems chapter 5 Exploded Views & Parts List Thumbnail Main Cover Ass samsung scx-4828fn lsu hsync error Cover Middle Frame Main Drive Scan Ass y

    4 Contents ADF Ass y Platen Ass y OPE Unit Duplex Unit Fuser Cassette SCF chapter 6 System Diagram Block Diagram Connection Diagram chapter 7 Reference Information Tool for Troubleshooting Acronyms and Abbreviations Acronyms Service Parts The Sample Pattern for the Test Selecting a location

    5 Precautions 1. Precautions In order to prevent accidents and to prevent damage to the equipment please read the precautions listed below carefully before servicing the printer and follow them closely. Safety Warning (1) Only to be serviced by appropriately qualified service engineers. High voltages and lasers inside this product are dangerous. This printer should only be serviced by a suitably trained and qualified service engineer. (2) Use only Samsung replacement parts There are no user serviceable parts inside the printer, samsung scx-4828fn lsu hsync error. Do not make any unauthorized changes or additions to the printer, these could cause the printer to malfunction and create electric shock or fire hazards. (3) Laser Safety Statement The Printer is certified in the U.S. to conform to the requirements of DHHS 21 CFR, chapter 1 Subchapter J for Class 1(1) laser products, and elsewhere, it is certified as a Class I laser product con-forming to the requirements of IEC Class I laser products are not considered to be hazardous. The laser system and printer are designed so there is never any human access to laser radiation above a Class I level during normal operation, user maintenance, or prescribed service condition. Warning >> Never operate or service the printer with the protective cover removed from Laser/ Scanner assembly. The reflected beam, although invisible, can damage your eyes. When using this product, these basic safety pre-cautions should always be followed to reduce risk of fire, electric shock, and injury to persons.

    6 Precautions Caution for safety Toxic material This product contains toxic materials that could cause illness if ingested. (1) If the LCD control panel is damaged it is possible for the liquid inside to leak. This liquid is toxic. Contact with the skin should be avoided, wash any splashes from eyes or skin immediately and contact your doctor. If the liquid gets into the mouth or is swallowed see a doctor immediately. (2) Please keep Drum cartridge and Toner Cartridge away from children. The toner powder contained in the Drum cartridge and Toner Cartridge may be harmful and if swallowed you should contact a doctor Electric Shock and Fire Safety Precautions Failure to follow the following instructions could cause electric shock or potentially cause a fire. (1) Use only the correct voltage, failure to do so could damage the printer and potentially cause a fire or electric shock. (2) Use only the power cable supplied with the printer. Use of an incorrectly specified cable could cause the cable to overheat and potentially cause a fire. (3) Do not overload the power socket, this could lead to overheating of the cables inside the wall and could lead to a fire. (4) Do not allow water or other liquids to spill into the printer, this can cause electric shock. Do not allow paper clips, pins or other foreign objects to fall into the printer these could cause a short circuit leading to an electric shock or fire hazard. (5) Never touch the plugs on either end of the power cable with wet hands, this can cause electric shock. When servicing the printer remove the power plug from the wall socket. (6) Use caution when inserting or removing the power connector. The power connector must be inserted completely otherwise a poor contact could cause overheating possibly leading to a fire. When removing the power connector grip it firmly and pull. (7) Take care of the power cable. Do not allow it to become twisted, bent sharply round corners or other wise damaged. Do not place objects on top of the power cable. If the power cable is damaged it could overheat and cause a fire or exposed cables could cause an electric shock. Replace a damaged power cable immediately, do not reuse or repair the damaged cable. Some chemicals can attack the coating on the power cable, weakening the cover or exposing cables causing fire and shock risks. (8) Ensure that the power sockets and plugs are not cracked or broken in any way. Any such defects should be repaired immediately. Take care not to cut or damage the power cable or plugs when moving the machine. (9) Use caution during thunder or lightening storms. Samsung recommend that this machine be disconnected from the power source when such weather conditions are expected. Do not touch the machine or the power cord if it is still connected to the wall socket in these weather conditions. (10) Avoid damp or dusty areas, install the printer in a clean well ventilated location. Do not position the machine near a humidifier. Damp and dust build up inside the machine can lead to overheating and cause a fire. (11) Do not position the printer in direct sunlight. This will cause the temperature inside the printer to rise possibly leading to the printer failing to work properly and in extreme conditions could lead to a fire. (12) Do not insert any metal objects into the machine through the ventilator fan or other part of the casing, it could make contact with a high voltage conductor inside the machine and cause an electric shock.

    7 Precautions Handling Precautions The following instructions are for your own personal safety, to avoid injury and so as not to damage the printer (1) Ensure the printer is installed on a level surface, capable of supporting its weight. Failure to do so could cause the printer to tip or fall. (2) The printer contains many rollers, gears and fans. Take great care to ensure that you do not catch your fingers, hair or clothing in any of these rotating devices. (3) Do not place any small metal objects, containers of water, chemicals or other liquids samsung scx-4828fn lsu hsync error to the printer which if spilled could get into the machine and cause damage or a shock or fire hazard. (4) Do not install the machine in areas with high dust or moisture levels, beside on open window or close to a humidifier or heater. Damage could be caused to the printer in such areas. (5) Do not place candles, burning cigarettes, etc on the printer, These could cause a fire Assembly / Disassembly Precautions Replace parts carefully, always use Samsung parts. Take care to note the exact location of parts and also cable routing before dismantling any part of the machine. Ensure all parts and cables are replaced correctly. Please carry out the following procedures before dismantling the printer or replacing any parts. (1) Check the contents of the machine memory and make a note of any user settings. These will be erased if the mainboard or network card is replaced. (2) Ensure that power is disconnected before servicing or replacing any electrical parts. (3) Disconnect printer interface cables and power cables. (4) Only use approved spare parts. Ensure that part number, product name, any voltage, current or temperature rating are correct. (5) When removing or re-fitting any samsung scx-4828fn lsu hsync error do not use excessive force, especially when fitting screws into plastic. (6) Take care not to drop any small parts into the machine. (7) Handling of the OPC Drum - The OPC Drum can be irreparably damaged if it exposed to light. Take care not to expose the OPC Drum either exception eoserror in module skype direct sunlight or to fluorescent or incandescent room lighting. Exposure for as little as 5 mins can damage the surface? photoconductive properties and will result in print quality degradation. Take extra care when servicing the printer. Remove the OPC Drum and store it in a black bag or other lightproof container. Take care when working with the covers(especially the top cover) open as light is admitted to the OPC area and can damage the OPC Drum. - Take care not to scratch the green surface of OPC Drum Unit. If the green surface of the Drum Cartridge is scratched or touched the print quality will be compromised.

    8 Precautions Disregarding this warning may cause bodily injury (1) Be careful with the high temperature part. The fuser unit works at a high temperature. Use caution when working on the printer. Wait for the fuser to cool down before disassembly. (2) Do not put finger or hair into the rotating parts. When operating a printer, do not put hand or hair samsung scx-4828fn lsu hsync error the rotating parts (Paper feeding entrance, motor, fan, etc.). If do, you can get harm. (3) When you move the printer - When transporting/installing the equipment be sure to hold the positions as shown in the reference chapter. The equipment is quite heavy and weighs approximately Kg (including consumables), therefore pay full attention when handling it. - Be sure not to hold the movable parts or units (e.g. the control panel, DADF) when transporting the equipment. - Be sure to use a dedicated outlet with V/Vpower input. - The equipment must be grounded for safety. - Select a suitable place for installation. Avoid excessive heat, high humidity, dust, vibration and direct sunlight. - Provide proper ventilation since the equipment emits a slight amount of ozone. - To insure adequate working space for the copying operation, keep a minimum clearance of 10cm ( on the left, 10 cm ( ) on the right and 18 cm ( ) on the rear. - The equipment shall be installed near the socket outlet and shall be accessible. - Be sure to fix and plug in the power cable securely after the installation so that no one trips over it.

    9 Precautions ESD Precautions Certain semiconductor devices can be easily damaged by static electricity. Such components are commonly called Electrostatically Sensitive (ES) Devices or ESDs. Examples of typical ESDs are: integrated circuits, samsung scx-4828fn lsu hsync error, some field effect transistors, and semiconductor chip components. The techniques outlined below should be followed to help reduce the incidence of component damage caused by static electricity. Caution >>Be sure no power is applied to the chassis or circuit, and observe all other safety precautions. 1. Immediately before handling a semiconductor component or semiconductor-equipped assembly, drain off any electrostatic charge on your body by touching a known earth ground. Alternatively, employ a commercially available wrist strap device, which should be removed for your personal safety reasons prior to applying power to the unit under test. 2. After removing an electrical assembly equipped with ESDs, place the assembly on a conductive surface, such as aluminum or copper foil, or conductive foam, to prevent electrostatic charge buildup in the vicinity of the assembly. 3. Use only a grounded tip soldering iron to solder or desolder ESDs. 4. Use only an anti-static solder removal device. Some solder removal devices not classified as anti-static can generate electrical charges sufficient to damage ESDs. 5. Do not use Freon-propelled chemicals. When sprayed, these can generate electrical charges sufficient to damage ESDs. 6. Do not remove a replacement ESD from its protective packaging until immediately before installing it. Most replacement ESDs are packaged with all leads shorted together by conductive foam, aluminum foil, or a comparable conductive material. 7. Immediately before removing the protective shorting material from the leads of a replacement ESD, touch the protective material to the chassis or circuit assembly into which the device will be installed, samsung scx-4828fn lsu hsync error. 8. Maintain continuous electrical contact between the ESD and the assembly into which it will be installed, until completely plugged or soldered into the circuit. 9. Minimize bodily motions when handling unpackaged replacement ESDs. Normal motions, such as the brushing together of clothing fabric and lifting one s foot from a carpeted floor, can generate static electricity sufficient to damage an ESD. Super Capacitor or Lithium Battery Precautions 1. Exercise caution when replacing a super capacitor or Lithium battery. There could be a danger of explosion and subsequent operator injury and/or equipment damage if incorrectly installed. 2. Be sure to replace the battery with the same or equivalent type recommended by the manufacturer. 3. Super capacitor or Lithium batteries contain toxic substances and should not be opened, crushed, or burned for disposal. 4. Dispose of used batteries according to the manufacture? instructions.

    10 Product spec and feature 2. Product spec and feature Product Overview Concept Optimized Desktop MFP for Small Workgroup Target Entry SMB SCXFN SCXFN

    11 Product spec and feature General Print Engine Items SCXFN SCXFN Packing Dimension System Memory OS

    12 Product spec and feature Items SCXFN SCXFN Items SCXFN SCXFN - Processor Memory Emulation Font fonts fonts Default

    13 Product spec and feature Items SCXFN SCXFN Items SCXFN SCXFN Gray Scale

    14 Product spec and feature Items SCXFN SCXFN Modem Speed Memory locations locations Functions Memory Back-up

    15 Product spec and feature Paper Handling Items SCXFN SCXFN Media Sizes Media types Sensing Paper empty sensor Paper empty sensor Media Sizes Media types Sensing Paper empty sensor Paper empty sensor Media Sizes Media types Sensing Output Stacking - - -

    16 Product spec and feature Items SCXFN SCXFN Consumables (CRU) Items SCXFN SCXFN T-DS/MLT-DL MLT-DS/MLT-DL Consumables (FRU) Image Items Life Part code Transfer roller 50K JC A Fuser 50K JC A(V) JC A(V) Pick up rubber 50K JC A Friction Pad (Cassette) 50K JC A Friction Pad (ADF) 20K JC A Pick up Assy(ADF) 20K JC A

    17 Product spec and feature Options Items SCXFN SCXFN Memory PS Standard

    18 Product spec and feature Model Comparison Samsung SCXFN Samsung SCXFN HP Mnf Speed Printer Default Processor Memory Emulation Modem Speed Scan Dimension

    19 Product spec and feature Summary of Product Printer Components Front View 1 Document width guides 9 Document output tray 2 ADF cover 10 USB memory port 3 Control panel 11 Paper level indicator 4 Output support 12 Optional tray 2 5 Front cover 13 Toner cartridge 6 Manual tray 14 Manual tray paper width guides 7 Tray 1 15 Scanner lid 8 Document input tray 16 Scanner glass

    20 Product spec and feature Rear View 1 2 Extension telephone socket (EXT) Telephone line socket 6 Handle 7 Control board cover 3 USB port 8 Rear cover 4 Network port 9 Power receptacle 5 pin optional tray connection 10 Power switch

    21 Product spec and feature System Layout - Engine Layout LSU DEVE FUSER DUPLEX CASSETTE - Scanner (ADF) Layout P S

    22 Product spec and feature Feeding 1) Separation method 2) Basic cassette 3) Pick-up roller 4) Registration roller 5) MP tray 6) Duplex unit 7) SCF (Second Cassette Feeder)

    23 Product spec and feature Transfer Driver Ass y Fuser 1) Thermostat 2) Heat roller 3) Pressure roller 4) Items for safety Safety device LSU (Laser Scanner Unit)

    24 Product spec and feature Print Cartridge D S

    25 Product spec and feature Main Board - Engine Part Direct USB Interface USB IC IC DDR2 SDRAM Power part DDR2 SODIMM USB Device Interface CHORUS3 Network IC IC Serial Flash NOR Flash EEPROM

    26 Product spec and feature (a) Asic(CHRUS3) Package

    27 Product spec and feature (b) Memory (C) Interface - Device

    28 Product spec and feature SMPS & HVPS board (a) HVPS (High Samsung scx-4828fn lsu hsync error Power Supply)

    29 Product spec and feature SW2 1 SW1 t- DE OP (b) SMPS (Switching Mode Power Supply)

    30 Product spec and feature NO ITEM CH1 CH2 Remark 1 2 SUNGHO Protection for loading current (~A) or Fuse Protection 5 SUNGHO F1 F1 V2C: V 8A 8A V1 V1 : V 10A 10A F71 F71 SH: SH: V 2A 2A F72 F72 V A A CON1 (AC (AC POWER CON.) CON2 (Heat Lamp CON.) CON3 (Main PBA PBA CON.) 24V 24V : V 5V : F02 F02 V A PC22 TLPF

    31 Product spec and feature SEM F1 F1 V2C: V 8A 8A V1 V1 : V 10A F71 SH: V 4A 4A F72 V 4A 4A CON1 (AC POWER CON.) CON2 (Heat Lamp CON.) CON4 (Main PBA CON.) 24V : V 5V : F02 V A PC51 TLPF (c) FUSER AC POWER CONTROL

    32 Product spec and feature Fax

    33 Product spec and feature Scan main function

    34 Product spec and feature Engine F/W (a) Control Algorithm Item Description (b) Driver (c) Transfer

    35 Product spec and feature (d) Fusing Error Description (e) LSU Error Polygon Motor Error Description

    36 Product spec and feature S/W Descriptions Overview Architecture Host Software is made up of Firmware is made up of

    37 Product spec and feature Data and Control Flow The above Block Diagram is explained that: Host Side is made up of

    38 Product spec and feature Firmware Side is made up of In Printing, the two procedures are The additional printing function are realized in

    39 Samsung scx-4828fn lsu hsync error and Reassembly 3. Disassembly and Reassembly General Precautions on Disassembly When you disassemble and reassemble components, you must use extreme caution. The close proximity of cables to moving parts makes proper routing a must. If samsung scx-4828fn lsu hsync error are removed, any cables disturbed by the procedure must be restored as close as possible to their original positions. Before removing any component from the machine, note the cable routing that will be affected. Releasing Plastic Latches Many of the parts are held in place with plastic latches. The latches break easily; release them carefully. To remove such parts, press the hook end of the latch away from the part to which it is latched. Whenever servicing the machine, you must perform as follows: 1. Check to verify that documents are not stored in memory. 2. Be sure to remove the toner cartridge before you disassemble parts. 3. Unplug the power cord. 4. Use a flat and clean surface. 5. Replace only with authorized components. 6. Do not force plastic-material components. 7. Make sure all components are in their proper position.

    40

    41 Disassembly and Reassembly General Disassembly Front Cover 1. Open the front cover after take out the cassette. 2. Separate the front cover from the lock the frame by pulling the front cover to the direction of arrow Rear Cover 1. Remove the Duplex unit. 2. Open the rear cover. And separate the rear cover from the locking by pulling the rear cover to the direction of arrow.

    42 Disassembly and Reassembly Right/Left Cover 1. Remove the one screw. And pull and release the right cover somewhat. 3. Pull the left cover to the direction of arrow and release it. 2. Release the right cover after unplug the 1 connector from Main PBA.

    43 Disassembly and Reassembly Scan and ADF Assy 1. Remove the 2 screws after remove the right cover. 2. Remove the one screw and connected harness from Main board. And lift the Scan Assy to the direction of arrow ADF Unit 1. Unplug the harness after remove the cap harness as shown below. 2, samsung scx-4828fn lsu hsync error. Lift up and release the ADF Assy.

    44 Disassembly and Reassembly Stacker TX 1. Remove the 2 screws from the bottom of ADF Assy. 2. Lift up and release the Stacker TX

    45 Disassembly and Reassembly ADF Engine unit 1. Open the ADF cover and remove it. And remove the samsung scx-4828fn lsu hsync error roller by following below sequence Locking 2. Remove the ADF engine unit after remove the 2 screws from the bottom of SET. 3. Remove the 2 screws of the ADF cover upper. And then lift it up.

    46 Disassembly and Reassembly OPE Unit 1. Pull up the OPE unit. 2. Remove the 2 connector and release the OPE unit. Hook CIS Unit 1. Remove the 4 screws of the Scan upper. 2. Remove the 4 screw and 1 CIS cable. And release the CIS unit.

    47 Disassembly and Reassembly Middle Cover 1. Remove the 2 screws as shown below. 2. Remove the 2 screws from the front and rear of the SET, samsung scx-4828fn lsu hsync error. Unplug the harness connected to the main board. And lift the middle cover up Fuser 1. Remove the rear cover. Remove the Guide rear by pushing both side and removing the hinge. 2. Remove the 4 screw, samsung scx-4828fn lsu hsync error. And remove the fuser after remove the connector. CAUTION The fuser is very hot. So turn the printer off gamemaker 8.1 error creating stand-alone cannot wait until the printer to cool before replacing it.

    48 Disassembly and Reassembly LSU 1. Release the LSU after remove the 4 screws and one connector Main Drive Assy - Before disassembly, remove the cassette, Cover front, Cover left, Cover rear. 1. Remove the rear cover. Remove the Guide rear by pushing both side and removing the hinge. 2. Remove the 4 screw. And remove the fuser after remove the connector.

    49 Disassembly and Reassembly HVPS/SMPS/Main board - Before disassembly, remove the cover front, cover rear, cover rigth. 1. Release the HVPS board after remove the 6 screws and 1 connector. 2. Release the SMPS board after remove the 4 screws and 2 connector. 3. Release the Main board after remove the 4 screws and all harness.

    50 Disassembly and Reassembly Transfer roller 1. Push HOLDER-TRANSFER, which holds the transfer roller and remove the roller from set, samsung scx-4828fn lsu hsync error. Caution - Be carefull not to touch the sponge of Transfer Roller.

    51 Disassembly and Reassembly Holder Pad unit 1. Remove the CASSETTE from SET. 2. Disassemble HOLER-PAD after putting out three HOOKs

    52 Alignment & Troubleshooting 4. Alignment & Troubleshooting This chapter describes the main functions for service, such as the product maintenance method, the test output related to maintenance and repair, DCU using method, Jam removing method, and so on. It includes the contents of manual. Alignment and Adjustments Control Panel overview 1 ID Copy You can copy both sides of the ID Card like a driver s license to a single side of paper. 2 Direct USB Reduce/Enlarge Allows you to directly print files stored on a USB Memory device when it is inserted into the USB memory port on the front of your machine. (SCX-4x28 Series only) Makes a copy smaller or larger than the original. (SCX-4x24 Series only) 3 Display Shows the current status and prompts during an operation. 4 Status 5 Fax 6 Copy 7 Scan/ Shows the status of your machine. Activates Fax mode. Activates Copy mode. Activates Scan mode. 8 Menu Enters Menu mode and scrolls through the available menus. 9 Left/right arrow Scroll through the options available in the selected menu, and increase or decrease values. 10 OK Confirms the selection on the screen. 11 Back Sends you back to the upper menu level. 12 Number keypad Dials a number or enters alphanumeric characters. Allows you to store frequently used fax numbers in memory or search for stored fax numbers 13 Address Book or addresses. 14 Redial/Pause In ready mode, redials the last number, or in Edit mode, inserts a pause into a fax number. 15 On Hook Dial Engages the telephone line, samsung scx-4828fn lsu hsync error. 16 Stop/Clear 17 Start Starts a job. Stops an operation at any time. In ready mode, clears/cancels the copy options, such as the darkness, the document type setting, the copy size, and the number of copies.

    53 Alignment & Troubleshooting Understanding The Status LED The color of the Status LED indicates the machine s current status. Status Off Description button is pressed, it switches to on-line automatically. Green On Blinking the computer. Red On the samsung scx-4828fn lsu hsync error, so that an error occurred while mounting /proc/bus/usb winpower machine cannot continue the job. Blinking cleared, samsung scx-4828fn lsu hsync error.

    54 Alignment & Troubleshooting Paper path Scanner Part PICK-UP COVER OPEN ADF-UPPER EXIT SCAN UPPER Engine Part LSU DEVE FUSER DUPLEX CASSETTE

    55 Alignment samsung scx-4828fn lsu hsync error Troubleshooting Clearing Document Jams Input Misfeed 1, samsung scx-4828fn lsu hsync error. Remove any remaining pages from the ADF. 2. Open the ADF cover. 4. Align the left end of the ADF roller with the slot and push the right end of the ADF roller into the right slot (1). Rotate the bushing on the right end of the roller toward the document input tray (2), samsung scx-4828fn lsu hsync error. 1 ADF cover 3. Rotate the bushing on the right end of the ADF roller toward the Error the namespace contains no legal characters (1) and remove the roller from the slot (2). Pull the document gently to the left and out of the ADF. 5. Close the ADF cover. Then load the removed page(s), if any, back into the ADF.

    56 Alignment & Troubleshooting Exit misfeed 1. Remove any remaining pages from the ADF. 2. Seize the misfeed paper, and remove the paper from the document output tray by carefully pulling it to the right using both hands. Roller misfeed 1. Open the scanner lid. 2. Seize the misfeed paper, and remove the paper from the feed area by carefully pulling it to the right using both hands. 3. Close the scanner lid. Then load the removed pages back into the ADF.

    57 Alignment & Troubleshooting Clearing paper jams locate and clear the paper jam. Message Paper Jam 0 Open/Close Door Paper Jam 1 Open/Close Door Paper Jam 2 Check Inside Duplex Jam 0 Check Inside Duplex Jam 1 Open/Close Door Location of jam In the paper feed area or inside the machine Inside the machine Inside the machine or in the fuser area Inside the machine In the paper feed area or inside the machine In the paper feed area If paper is jammed in the paper feed area, follow the next steps to release the jammed paper. 2. Remove the jammed paper by gently pulling it straight out as shown below. 1. Pull the tray open. If the paper does not move when you pull, or if you do not see the paper in this area, check In the toner cartridge area. 3. Insert the tray back into the machine. Printing automatically resumes.

    58 Alignment & Troubleshooting In the manual tray machine detects that there is either no paper or that the paper has been improperly loaded, follow the next steps to release the jammed paper, samsung scx-4828fn lsu hsync error. 1. Check if the paper is stuck in the feeding area, and if so, pull it out gently and slowly. In the toner cartridge area If paper is jammed in the toner cartridge area, follow the next steps to release the jammed paper. 1. Open the front cover and pull the toner cartridge out 3. Open the front cover and close it. The machine will resume printing. 2. Remove the jammed paper by gently pulling it straight out as shown below. 3. Replace the toner cartridge and close the front cover. Printing automatically resumes, samsung scx-4828fn lsu hsync error.

    59 Alignment & Troubleshooting In the paper exit area If paper is jammed in the paper exit area, follow the next steps to release the jammed paper. 1. If a long portion of the paper is visible, pull it straight out. Open and close the front cover In the duplex unit area If the duplex unit is not inserted correctly, paper jam may occur. Make sure that the duplex unit is inserted correctly. 1. Pull the duplex unit out of the machine. any resistance removing the paper, stop pulling and go to step Open the rear cover. 2. Remove the jammed paper from the duplex unit. 3. Pull the guide rear on each side down and carefully take the jammed paper out of the machine. Return the guide rear to its original position. If the paper does not come out with the duplex unit, remove the paper from the bottom of the machine. 1 Guide rear 4. Close the rear cover. Printing automatically resumes. any resistance removing the paper, stop pulling and go to step

    60 Alignment & Troubleshooting 3. Open the rear cover. 4. Pull the guide rear on each side down and remove the paper. Return the guide rear to its original position. 2. If you see the jammed paper, remove the paper from the machine by gently pulling it straight out as a situation des etrangers soupconnes de terrorisme below. any resistance removing the paper, stop pulling and go to step Pull the tray half. 1 Guide rear 5. Close the rear cover. Printing automatically resumes. In the optional tray If paper is jammed in the optional Tray, follow the next steps to release the jammed paper. 1. Pull the optional tray open. 4. Remove the jammed paper by gently pulling the paper straight up and out. 5. Insert the trays back into the machine. Printing automatically resumes.

    61 Alignment & Troubleshooting Menu Map The control panel provides access to various menus to set up the machine or use the machine s functions. These menus can be accessed by pressing Menu. Refer to the following diagram. Menus available in Fax, Copy, or Scan mode vary. Fax Feature Darkness Resolution Multi Send Delay Send Prio rity Send Forward Secur e Receive Add Page Cancel Job Fax Setup Sending Redial Tim es Redial Term Prefix Dial ECM Mode Send Report Image TCR Dial Mode Receiving Receiv e Mode Ring to An swer Fax Setup (Continued) Stamp Rcv Name Rcv Start Code Auto Re duction Discard Size Junk Fax Setup DRPD Mode Dupl ex Print Change Defaul t Resoluti on Darkness Auto Re port Copy Feature Reduce/Enlar ge Darkness Original Type out Norm al 2-Up 4-Up ID Copy Poster Cop y Clon e Copy Adjus t Bkgd. Network TCP/IP Ethern et Speed Clear Settin g Network I nfo Copy Setup Duple x Change Default Copie s Copy Colla tion Reduce/Enlar ge Darkness Original Type System Setup (Continued) Clear Settin g All S etting s Fax Setup Copy Setup Scan Setup System Setup Network Addre ss B ook Sent Report Fax Rcv Report Scan Feature USB Feature Scan Size Original Type Resolutio n Scan Colo r Scan Form at Feature Scan Size Original Type Resolutio n Scan Colo r Scan Form at System Setup (Continued) Report All Report Configura tion Supplie s Info Address Book Send Report Sent Report Fax Rcv Repor t Schedule Jobs Junk Fax Report Network Info. User Auth t Maintenance R Empty Msg Ignore Tone r Supplie ife Serial N umber Scan Setup Change Default USB Default Defa ult System Setup Machine Setup Machine ID Machine Fax No. Date & Time Clock Mod e ngu age Default Mode Power Save Timeout Job Timeout Alt itude Adj. Import Setting Export Se tting Paper Setup Paper Si ze Paper Type Paper So urce Sound/Vo lum e Key Sound Alarm Sound Speaker Ringer.

    62 Alignment & Troubleshooting Accessing to menus The next steps are the example to print the menu map of this machine, and they are the general way to 1. Make sure your machine is properly connected all the necessary cables, and turn on the machine. 2. Press the Menu button until you see the menu (ex. Information) you want on the bottom line of the display. 3. Press the OK button to access the menu. line. 7. Press the OK button to process your selection, save your input or selection. An asterisk (*) appears next to the selection on the display, indicating that it is now the default. 8. To exit the menu, press the Back button repeatedly, or the Stop button. Note - If you want to set the basic menu items, please consult the user guide.

    63 Alignment & Troubleshooting Tech Mode How to Enter Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction, samsung scx-4828fn lsu hsync error. To enter the Tech mode To enter the Tech mode, press Setting-up System in Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction. SCXFN/FN Pause Time Dial Mode Modem Speed Error Rate RDS Clear All Mem Clear Counts Flash Upgrade Silence Time Switch Test Modem Test Dram Test Rom Test Pattern Test Shading Test All Report Protocol Configuration Error Info Usage Page Component Check Service Support

    64 Alignment & Troubleshooting Data Setup SEND LEVEL You can set the level of the transmission signal. Typically, the Tx level should be under dbm. arbitrarily. DIAL MODE This function can choose dial method. *Default : Dial(Dial/Pulse) MODEM SPEED You can set the maximum modem speed. Communication is done with modem speed automatically set at lower speed when communicating with a slower speed modem since communication is done on the standard of the side where modem speed is low for transmission/reception. It is best set Kbps as default setting. ERROR RATE This ensures that the error rate remains below the set value. You can select the rate between 5% and 10%. CLEAR ALL MEMORY The function resets the system to factory default settings. This function is used to reset the system to the initial value when the product is functioning abnormally. All the values are returned to the default values, and all the information, which was set by the user, will be erased. < Method > 2. Push the OK button. 3. Select you country. (There are four country groups. Refer to the table below.) 4. Push the OK button then it will clear all memory. NOTICE : Always perform a memory clear after replacing the main board. Otherwise, the system may not operate properly. Country Group USA/Canada UK Russia Southafrica Country USA/Canada Mexico Brazil UK Germany France Italy Spain Austria Netherlands Belgium Portugal Sweden Norway Denmark Finland Switzerland Greece Ireland Turkey Russia India Oman Poland Bangladesh Kuwait Moroco Algeria Pakistan UAE Bahrain Srilanka Saudi Arabia Chile Peru Argentina Romania Bulgaria Czech South Africa

    65 Alignment & Troubleshooting Flash Upgrade 1) Local Machine Upgrade This method is for USB Port Connect to PC and activate RCP(Remote Control Panel) to upgrade the Firmware. < Method > 1. Connect PC and Printer with USB Cable. 2. Execute RCP and select Firmware Update. 5. Click Refresh icon and check what is updated. This method is just for USB Port. Connect to PC with USB cable and enter DOS Command to upgrade the Firmware < Method > 2. In the DOS, input as below and push the enter key. Then, it will be automatically upgraded. 3. There are two commands for the conditions of product. 4. Do not turn off the power while upgrading process. 2) Remote Upgrade line. < Method > 2. Input the fax number, which needs to be upgraded. (Several faxes can be upgraded at the same time. In this case, enter the each fax number.) < Caution > 1. sending and receiving fax must be the same model. 2. A sending fax must be set up as ECM mode, and a receiving memory must be set up as %. If not, the function operates abnormally

    66 Alignment & Troubleshooting S/W of Maintenance 1. Clearing the Memory 1) Press Menu on the control panel until Maintenance appears on the top line of samsung scx-4828fn lsu hsync error display. 2) Press the scroll button (left-key or right-key) until you see Clear Memory on the bottom line and press OK 3) Press the scroll button (left-key or right-key) until you see the item you want to clear. 4) Press Enter. The selected memory is cleared and the display asks you to continue clearing the next item. 5) To clear another item, press Enter and repeat steps 3 and 4 - To return to Standby mode, press Stop/Clear. - As below item you can selectively clear information stored in your machine s memory. - Clears all of the data stored in the memory and resets all of your settings to the factory default. - Restores all of the Paper Setting options to the factory default. - Restores all of the Copy Setup options to the factory default. - Restores all of the Fax Setup options to the factory default. - Cancels all of the scheduled fax jobs in the machine s memory. - As below item you can selectively clear information stored in your machine s memory. - Restores all of the Advanced Fax setting options to the factory default. - Resets the sound and volume settings to the factory default. - Resets all of the system settings, such as the machine ID, date and time, display language and save modes, to the factory default. - Clears all of records of your faxes sent. - Clears all of records of your faxes received. - Clears the one-touch, speed and group dial numbers stored in the memory. 2. Adjust shading 2) Make machine Tech mode. 3) Press Menu on the control panel and scroll until Samsung scx-4828fn lsu hsync error Test displays. 4) Scroll to Shading Test and Press OK. 5) Select Shading&Print appears on the bottom line and press OK. 6) Your machine picks up the paper and adjusts the shading value. 7) After adjusting, shading value will be printed with graphic image.

    67 Alignment & Troubleshooting 3. Remote Diagnostic System(RDS) service and monitor the performance of the MFP at the customer site. Required components of RDS RDS for MFP system consists of the following three components that communicate with each other 1. Main RDS Server connected to FAX-MODEM. 2. Block error abrt Client Application. 3. RDS on MFP. Enable of RDS on MFP This value is in Tech Mode. The factory default for Consumables Status Update / Error Proactive value is Disabled. < Method > 1. MFP Should be connected by RDS Server. 2. Service numbers should have the proper values. 3. Machine Serial No. should have samsung scx-4828fn lsu hsync error ios error 2005 values. 4. Criter value input is optional, default is samsung scx-4828fn lsu hsync error to page. 5. Remote Test should be On 6. Change the password : if you forgot the Notify Toner password, enter the new password. Call setup & Release In order to perform any RDS activity on a Customer MFP, the SVC will have to setup a call to it. manually initiated. invalid string, samsung scx-4828fn lsu hsync error, user will be prompted to enter a valid serial no. for the device. If the user chooses not to enter other MFP parameter Tel. No, Model, Server Port (that is connected to), Status, Serial Number, Firmware Version, Engine Version, Emulation Version It will then be necessary to manually request for another call setup to the desired MFP before any RDS function can be reattempted. will be released / disconnected from the MFP-side.

    68 Alignment & Troubleshooting Machine Test SWITCH TEST each time you press a key. MODEM TEST Use this feature to hear various transmission signals to the telephone line from the modem and to check the modem. If no transmission signal sound is heard, it means the modem part of the main board malfunctioned. DRAM TEST ROM TEST PATTERN TEST Using this pattern printout, you can check if the printer mechanism is functioning properly. It is needed in the production progress. Service person doesn t need to use it. SHADING TEST Device). If the copy image quality is poor, perform this function to check the condition CCD unit. < Method > 2. Push the SET UP button then an image will be scanned. print out. samsung scx-4828fn lsu hsync error. If the printed image is different to the image, the CCD is defect. NOTICE : When you test CCD, make sure that the cover is closed.

    69 Alignment & Troubleshooting Report PROTOCOL LIST This list shows the sequence of the CCITT group 3 T protocol during the most recent sending or receiving operation. Use this list to check for send and receive errors. If a communication error occurs while the OTHER ITEM This list provides a list of the user system data settings and tech mode settings.

    70 Alignment & Troubleshooting supplies information report

    71 Alignment & Troubleshooting EDC Mode EDC Mode is independently controled system f/w and diagnose printer s each function. 2. To enter the EDC Mode, Push the button like next time.

    72 Alignment & Troubleshooting 0. Cover Status Front Cover Item Description 1. Sensor Status Item Regi/Feed/Exit Sensor Empty Description be. 2. Motor Test Item Main Mtr Nor. Slow Description displayed. 3. Fan Test Fuser Fan SMPS Fan Item Description 4. Clutch Test Item Pick up Clutch Regi Clutch Description displayed. displayed.

    73 Alignment & Troubleshooting 5. Fuser Ctrl Item Temp Control Fuser Temp. Description display 6. LSU Control Item Description will be displayed after 10 seconds will be displayed. will be displayed. 7. DEV Control Item Dev Bias Description

    74 Alignment & Troubleshooting Abnormal Image Printing and Defective Roller If abnormal image prints periodically, check the parts shown below No Roller Abnormal image period Kind of abnormal image 1 OPC Drum mm 2 Charge Roller mm Block Spot and Periodic Band 3 Supply Roller mm Periodic Band by little difference of density 4 Developing Roller mm 5 Transfer Roller 47mm Ghost, Damaged Image by abnormal transfer mm Black Spots or Vertical Black Band mm Blackground mm Blackground

    75 Alignment & Troubleshooting Error Message Messages appear on the control panel display to indicate the machine s status or errors. Refer to the tables below to understand the messages meaning and correct the problem if necessary. Messages and their meanings are listed in alphabetical order. Message Meaning Suggested solutions [COMM. Error] The machine has a communication Ask the sender to try again. problem. [Incompatible] [Line Error] [No Answer] [Stop Pressed] [yyy] Paper Empty [yyy] Paper Mismatch Authentication Failure Cancel? Yes Connection Error The machine has received a fax from which is registered as a junk fax. Your machine cannot connect with the receiving fax machine or has lost contact because of a problem with the phone line. The receiving fax machine has not answered after several redial attempts. Stop/Clear has been pressed during an operation. There is no paper in the tray. properties does not match the paper you are loading. The ID or password you entered is incorrect. Your machine s memory has become full while trying to store an original into memory. Connection with the SMTP server failed. The received fax data will be deleted. Try again. If the problem persists, wait an hour or so for the line to clear and try again. Or, turn the ECM mode on. Try again. Make sure that the receiving machine is operational. Try again. Enter the correct ID or password. To cancel the fax job, press the OK button to accept Yes. If you want to send those pages that have been successfully stored, press the OK button to accept No. You should send the remaining pages later, when memory is available. Check the server settings and the network cable. Data Read Fail Check USB Mem. Data Write Fail Check USB Mem. Time expired while reading data, samsung scx-4828fn lsu hsync error. Storing to the USB memory failed. Try again. Check the available USB memory space.

    76 Alignment & Troubleshooting Message Meaning Suggested solutions Document Jam The loaded original has jammed in the Clear the jam. ADF. Door Open Duplex Jam 0 Check Inside Duplex Jam 1 Open/Close Door The front cover is not securely latched. Paper has jammed during duplex printing. This is applicable only to machines with this feature. Paper has jammed during duplex printing. This is applicable only to machines with this feature. Close the cover until it locks into place. Clear the jam. Clear the jam. Enter Again You entered an unavailable item. Enter the correct item again. File Format Not Supported Fuser Fan Locked Group Not Available supported. There is a problem in the cooling fan of the machine. You have tried to select a group location number where only a single location number can be used, such as when adding locations for a Multiple Send operation. Open and then close the front cover. Use a speed dial number or dial a number manually using the number keypad. Install Toner The toner cartridge is not installed. Install the toner cartridge. Invalid Toner The toner cartridge you have installed Install the a Samsunggenuine toner is not for your machine. cartridge designed for your machine. Line Busy Low Power Mail Exceeds Server Support The network IP address you have set is being used by someone else. The receiving fax machine did not answer or the line is already engaged. The machine is in the previous stage of the power save mode. The mail size is larger than the supported size by SMTP server. Check the IP address and reset it if necessary. Try again after a few minutes. on-line automatically. Divide your mail or reduce the resolution. Main Motor Locked There is a problem in the main motor. Open and then close the front cover. Memory Full The memory is full, samsung scx-4828fn lsu hsync error. Delete unnecessary fax jobs and retransmit after more memory becomes available. Alternatively, samsung scx-4828fn lsu hsync error, split the transmission into more than one operation. Not Assigned The speed button or speed dial number you tried to use has no number assigned to it. Enter the number manually using the number keypad or store the number or address.

    77 Samsung scx-4828fn lsu hsync error & Troubleshooting Not Available Try Again Later One Page is Too Large Operation Not Assigned Out-Bin Full Message Meaning Samsung scx-4828fn lsu hsync error solutions Paper Jam 0 Open/Close Door Paper Jam 1 Open/Close Door Paper Jam 2 Check Inside Replace Toner Retry Redial? Can not perform the task immediately because too many tasks are running at once. Single page data exceeds the You are in the Add Page/Cancel Job operation, but there are no jobs stored. The output tray of the machine is full of paper. Paper has jammed in the feeding area of the tray. Paper has jammed inside the machine. Special print media has jammed in the paper exit area. This message appears between Toner time interval to redial a previously busy station. Try again when current task is completed. Reduce the resolution and try again. Check the display to see if there are any scheduled jobs. Remove paper. Clear the jam. Clear the jam. Clear the jam. Replace the toner cartridge with a new one. You can press OK to immediately redial, or Stop/Clear to cancel the redial operation. Scanner locked The scanner module is locked Unlock the scanner and press Stop/ Clear. Self Diagnostics Temperature Self Diagnostics LSU Send Error (AUTH) Send Error (DNS) Send Error (POP3) Send Error (SMTP) Send Error The engine in your machine is checking problems detected. your machine is checking problems detected. There is a problem in SMTP authentication. There is a problem in DNS. There is a problem in POP3. There is a problem in SMTP. There is a problem on the network interface card. Change to the available server. correctly.

    78 Alignment & Troubleshooting Message Meaning Suggested solutions Toner Empty The toner cartridge has run out. The machine stops printing. Press OK to toggle the message to Stop or Continue. Stop You can select the option among Stop or Continue with the left/right arrow. If you select Stop by pressing OK on the control panel, the machine stops printing. If you select Continue, the machine keeps printing, but the quality cannot be guaranteed. If you do not select any, the machine will work as Samsung scx-4828fn lsu hsync error is selected. Replace the toner cartridge with a new one. Toner Exhausted Toner Low Updating Data Please Wait The lifespan of the toner cartridge which the arrow indicates is reached. The corresponding toner cartridge is almost empty. This message appears when there is a change in the system setting or when you back up a data. This message appears when the toner is completely empty, and your machine stops printing. Replace the corresponding toner cartridge with a Samsunggenuine cartridge. Take out the toner cartridge and thoroughly shake it, samsung scx-4828fn lsu hsync error. By doing this, you can temporarily reestablish printing operations. Do not turn the power off when this message is showing. Changes may not be saved and datas can be lost.

    79 Alignment & Troubleshooting Troubleshooting Procedure of Checking the Symptoms Power On - No Power - Power Module error - Main PBA error - Panel PBA error Ready or Power save Refer to Error Message Test Print printing Quality is Refer to "Solution of Image Problem" END

    80 Alignment & Troubleshooting The cause and solution samsung scx-4828fn lsu hsync error Bad image 1) Vertical Black Line and Band Description : 1. Straight thin black vertical line occurs in the printing. 2. Dark black vertical band occur in the printing. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Damaged develop roller in the Toner cartridge. Deformed Doctor-blade or cleaning-blade. 2. Scratched surface of the charge roller in the toner cartridge. If causes 1 and 2 occur in the toner cartridge, replace the toner cartridge and try to print out. 3. Partly depression or deformation on the surface of the transfer roller. Replace the transfer roller if occurred as No

    81 Alignment & Troubleshooting 2) Vertical White Line Description : White vertical voids in the image. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Foreign matter stuck onto the window php fatal error out of memory file_get_contents internal lenses. Foreign matter stuck onto the with recommended cleaner(ipa) Clean the window with a clean cotton swab. 2, samsung scx-4828fn lsu hsync error. Foreign matter or toner particles between the toner cartridge roller and blade. samsung scx-4828fn lsu hsync error case the life of the toner cartridge has been expired, white lines or light image occur in front of the image.) Replace the toner cartridge, samsung scx-4828fn lsu hsync error. 3. It may occur when Burr and foreign substances are on the window of the toner cartridge frame. No 3. : Remove the foreign matter and burr of the exposure window. (toner cartridge) 4. If the fuser is defective, voids occur periodically at the top of a black image, samsung scx-4828fn lsu hsync error. No. 4. : Open the front cover and check ribs that corresponds to the position of the voids. Remove if found. 5. It may occur when foreign substances award phoenix bios error codes on the OPC Drum. If the problems are not solved, replace the toner cartridge. 6. Partly depression or deformation on the surface of the transfer roller Replace the transfer roller if occured as NO

    82 Alignment & Troubleshooting 3) Horizontal Black Band Description : Dark or blurry horizontal stripes occur in the printing periodically. (They may not occur periodically.) Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Bad contacts of the voltage terminals to toner cartridge. Clean each voltage terminal of the Charge, Supply, Develop and Transfer roller, samsung scx-4828fn lsu hsync error. (remove the toner particles and paper particles) 2. The rollers of toner cartridge may be stained. Charge roller = mm Supply roller = mm Develop roller = mm Transfer roller = 47mm 1. Clean the right Gear that has relatively small gap of the teeth in the OPC. 2. If the malfunction persists, replace the toner cartridge.

    83 Alignment & Troubleshooting 4) Black/White Spot Description : 1. Dark or blurry spots occur periodically in the printing 2. White spots occur periodically in the printing Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. If dark or blurry black spots occur periodically, the rollers in the Toner cartridge may be contaminated with foreign matter or paper particles. ( Charge roller : mm interval OPC drum : mm interval) Run OPC cleaning Mode Print and run the Self-test 2 or 3 times. 2. If faded areas or voids occur in a black image at intervals of mm, or black spots occur elsewhere, the OPC drum surface is damaged. In case of mm interval unremovable in 1, cleanly remove foreign substances stuck on the OPC location equivalent to black spots and white spots with a dry duster. 3. If a black image is partially broken, the transfer voltage is abnormal or the transfer roller's life has expired. 1. The transfer roller guarantees 50, sheets printing. If the roller's life is expired, replace it. 2. In case of mm interval unremovable in samsung scx-4828fn lsu hsync error, take measures as to replace the toner cartridge and try to print out. 3. Clean the inside of the set against the paper particles and foreign matter in order not to cause the trouble.

    84 Alignment & Troubleshooting 5) Light Image Description : The printed image is light, with dovecot anvil error code 71 ghost. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Develop roller is stained when the toner of toner cartridge is almost consumed. Check if the Toner Save mode is off. Check if the density is light. No 1 : Replace the toner cartridge and try to print out, samsung scx-4828fn lsu hsync error. 2. Ambient temperature is below than ait 30 minutes after printer is powered on before you start printing. 3. Bad contact caused by the toner stains between the high voltage terminal in in the set. No3 : Clean up the contaminated area by the toner. 4. Abnormal output problems are not solved by the above four instructions.

    85 Alignment & Troubleshooting 6) Dark Image or a Black Page Description : The printed image is dark. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. No charge voltage in the engine board. Check the state of the connector which connects the engine board 2. Charge voltage is not turned on due to the bad contacts between power supply in the side of the Toner cartridge and charge terminal 1. Clean the high voltage charge terminal. by the above direction 1 and VD0 signal of the Main PBA

    86 Alignment & Troubleshooting 7) Uneven Density Description : Print Density is uneven between left and right. 1. The pressure force on the left and right springs of the transfer roller is not even, the springs are damaged, the transfer roller is improperly installed, or the transfer roller bushing or holder is damaged. Replace both the left and right. 2. The life of the Toner cartridge has expired. Occur in the toner cartridge gently shake the toner cartridge. 3. The toner level is not even on the toner cartridge roller due to the bad blade, samsung scx-4828fn lsu hsync error. Replace the toner cartridge and try to print out.

    87 Alignment & Troubleshooting 8) Background Description : Light dark background appears in whole area of the printing. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Does character exist less than 2% per a page, and hasnõt it been The toner cartridge is basically designed to print 7K sheets with 5% image. If it prints more than 8K sheets with 2% coverage, a background can occur. The A/S is not guaranteed if using a recyled the toner cartridger. Replace the toner cartridge when the life span of it has been ended. 4. Is the movement(up and Down) Clean the bushing part of the transfer roller. 1, samsung scx-4828fn lsu hsync error. If the problem is still not solved, replace the toner cartridge. 2. Gently shake the toner cartridge.

    88 Alignment & Troubleshooting 9) Ghost (1) Description : Ghost occurs at mm intervals of the OPC drum in the whole printing. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer mm 1. Samsung scx-4828fn lsu hsync error contacts caused by contamination from toner particles between high voltage terminal in the main body and the electrode of the Toner cartridge. Clean the terminals when contaminated by toner particles. 2. Bad contacts caused by contamination from toner particles between high voltage terminal in the main body and the one in the Occur in the toner cartridge, replace the toner cartridge and try to print out. 3. The life of toner cartridge is expired. Replace the engine board if not solved by the above directions Transfer roller lifetime(50k sheets) has expired. If not solved by the direction 3, check the transfer roller lifetime and replace it. Continue

    89 Alignment samsung scx-4828fn lsu hsync error Troubleshooting Continue. 5. Abnormal low temperature (below 10 ). ait about 1 hour after power on before using printer. 6. Damaged cleaning blade in the toner cartridge. Occur in the toner cartridge, replace the toner cartridge and try to print out.

    90 Alignment & Troubleshooting 10) Ghost (2) Description : Ghost occurs at mm intervals of the OPC drum in the whole printing. (When printing on card stock or lm error process instance run error 5 using manual feeder) Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer mm thicker than normal paper or, higher transfer voltage is required. Select 'Thick Mode' on paper type menu from the software application and after using returning to the original mode is recommended.

    91 Alignment & Troubleshooting 11) Ghost (3) : Fuser Description : Ghost occurs at mm or mm intervals. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer or mm The temperature of the fuser is maintained high. Disassemble the fuser and remove the contaminated toner particles on the roller and clean the foreign matter between Thermistor and. (Caution: can be deformed)

    92 Alignment & Troubleshooting 12) Stains on the Face of Page Description : The background on the face of the printed samsung scx-4828fn lsu hsync error is stained. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Toner leakage due to improperly sealed toner cartridge. Replace the toner cartridge. 2. If the transfer roller is contaminated, stains on the face of page will occur. If the transfer roller is contaminated, samsung scx-4828fn lsu hsync error, run PC Cleaning Mode Print 2 or 3 times. And perform Self-Test 2 or 3 times to remove contamination.

    93 Alignment & Troubleshooting 13) Stains on Back of Page Description : The back of the page is stained at 47 mm or mm intervals. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 47 or mm 1. 47mm : Transfer roller is contaminated. Perform the OPC Cleaning Mode Print 2 or 3 times. Run Self-Test to remove the contamination of the transfer roller mm : Pressure roller is contaminated. 1. Replace the transfer roller if contaminated severely. 2. Disassemble the fuser and clean (Pressure roller). And check the Thermistor, samsung scx-4828fn lsu hsync error. If contaminated, clean the area not to be deformed.

    94 Alignment & Troubleshooting 14) Blank Page Print out (1) Description : Blank page is printed. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Bad ground contacts in OPC and/or toner cartridge. 1. Check if the Ground-OPC is defective(set inside right side). 2. Remove contamination of the terminals of the toner cartridge and the unit.

    95 Alignment & Troubleshooting 15) Blank Page Print out (2) Description : 1. Blank page is printed. 2. One or several blank pages are printed. 3. When the printer turns on, several blank pages print. 1, samsung scx-4828fn lsu hsync error. Bad ground contacts in OPC and/or toner cartridge. Remove contamination of the terminals of the toner cartridge. 2. Abnormal solenoid. 1. Perform the engine self test using EDC Mode to check if the Solenoid is normal. 2. If not solved by the above directionsReplace the engine board. 3. Turn the power off, delete the data of PC and try printing again.

    96 Alignment & Troubleshooting The cause and solution of the bad discharge 1) Wrong Print Position Description : Printing begins at wrong position on the paper. rong sense time caused by defective feed sensor actuator. Replace the defective actuator

    97 Alignment & Troubleshooting 2) JAM 0 Description : 1. Paper is not exited from the cassette. 2. Jam-0 occurs when the paper feeds into the printer 1. Check the Solenoid by using EDC Mode. Replace the solenoid. 2. Check if the pad is loose due to bad sealing of the side-pad. Replace the side-pad Assembly or R, if necessary. 3. Check the surface of the roller-pickup for foreign matter. Clean with soft cloth dampened with IPA(Isopropyl Alcohol) or water. 4. If continuous clusters occur, check whether the assembly slot between shaft-pickup and housing-pickup opens or is broken away. Replace the Main PBA and/or Sensor. 5. If the paper feeds into the printer and Jam 0 occurs, perform EDC Mode to check feed-sensor of the engine board.

    98 Alignment & Troubleshooting 3) JAM 1 Description : 1. Recording paper is jammed in front of or inside the fuser. 2. Recording paper is stuck in the discharge roller and in the fuser just after passing through the Actuator-Feed. 1. If the recording paper is jammed in front of or inside the fuser. Replace the SMPS or Exit-Sensor. 2. If the recording paper is stuck in the discharge roller and the fuser just after passing through the Actuator-Feed, Feed Actuator may be defective. 1. Replace the Main PBA. 2. Reassemble the Actuator-Feed and Spring-Actuator if the movement is bad.

    99 Alignment & Troubleshooting 4) JAM 2 Description : 1. Recording paper is jammed in front of or inside the fuser. 2, samsung scx-4828fn lsu hsync error. Recording paper is stuck in the discharge roller and in the fuser just after passing through the Actuator-Feed. 1. If the paper is completely fed out of the printer, but Jam 2 occurs : Exit sensor is defective. After the paper is completely discharged, actuator Exit should return to the original position to shut the photo-sensor. Sometimes samsung scx-4828fn lsu hsync error takes longer hour than it should and does not return. Check if the exit sensor actuator is defective. Check if the actuator exit is deformed (Check if the lever part is deformed in shape). Check whether burrs occur in the assembly part of the actuator exit or not and if the actuator is smoothly operated. Check if foreign matter and wire get caught in the actuator exit's operation. 2. If the paper is rolled in the Fuser Roller: This occurs when a Guide claw is broken away or transformed. It occurs when the Spring of a Guide claw is broken away or transformed. Pressure-Roller is seriously contaminated with the toner. 3. Paper is accordion in the fuser. If the paper is stuck in the fuser : disassemble samsung scx-4828fn lsu hsync error fuser and remove the jammed paper, and clean the surface of the pressure roller with dry gauze. Remove the jammed paper after disassembling the fuser : Clean the surface of the pressure roller with dry gauze. Remove the toner particles stained on the rib. Check the assemblage and performance of the exit.

    Alignment & Troubleshooting 5) JAM Duplex Description : Recording paper is Jamned in front or inside a duplex module. 2. It is a case that a paper cannot reach to a registration sensor, samsung scx-4828fn lsu hsync error. 1. A case that a paper jam occurs on (A) after it is reversed: replace a 2nd exit roller after checking its operation. 2. A case that a paper jam occurs on (B) after it is reversed: replace a duplex roller after checking its operation

    Alignment & Troubleshooting 6) Multi-Feeding Description : Multiple sheets of paper are fed at once. Rear in the Cassette, if the position is correct. Replace the solenoid if necessary. 2. Solenoid malfunction (the solenoid does not work properly): Perform Samsung scx-4828fn lsu hsync error Mode. Replace the Main PBA. 3. Pad-Friction is contaminated with foreign matter.(oil) Clean the pad friction with soft cloth dampened with IPA (Isopropyl Alcohol). 4. The face of paper is blended. Use the smooth paper.

    Alignment & Troubleshooting 7) Paper rolled in the fuser Description : If contaminated at intervals of mm on the back of a paper. 1. Contamination of the pressure roller or heat roller f set). After disassembling the fuser, clean contamination between the heat roller and the thermostor and remove the contamination of the pressure roller. 2. Check the claw of the fuser whether it is deformed. 1. If there is heavy background, repair it by the background troubleshooting method. 2. Clean the surface of the heat roller with IPA or water 3. Check the warp or separation of the print claw and the holder plate claw, and then manage samsung scx-4828fn lsu hsync error.

    Alignment & Troubleshooting 8) Paper rolled on the OPC Drum Description : Paper is rolled up in the OPC, samsung scx-4828fn lsu hsync error. 1. Paper is too much thin. Recommend to use normal paper. 2. The face of paper is curled. in the OPC. Remove the paper while turning the OPC against the ongoing direction. Clean fingerprints on the OPC softly with soft cloth dampened with tissue.

    Alignment & Troubleshooting The cause and solution of the malfunction 1) Fuser Error Description : Fuser error is displayed on LCD 1. Check whether a thermostat, AC wire, and heat lamp are open or not. Replace the fuser if a thermostat is open. 2. Check whether a thermistor is open or not. Replace the fuser if a thermistor sensor is located deep inside of a sponge. Check whether the overheat mode circuit operates normally or not. 4. It could not operate due to a gear of a fuser is melted. Replace the fuser.

    Alignment & Troubleshooting 2) LSU Error Description : PMOTOR ERROR/HSYNC ERROR connector is disconnected or not. motor is rotating or not. Replace a main board if the same error occurs again after replacing

    Alignment & Troubleshooting 3) Not function of the gear of the fuser due to melting away Description : The motor breaks away from its place due to gear melting away. 1. Replace the Fuser. 2. Replace the Main PBA. 3. Replace the SMPS.

    Alignment & Troubleshooting 4) Paper Empty Description : Paper empty error message is displayed on LCD when paper is loaded in the cassette. 1. Bending or deformation of the actuator of the paper sensor. Replace the defective actuator. 2. The function of the engine board is defective Replace the Sensor PBA. 3. Check the Connector.

    Alignment & Troubleshooting 5) Paper Empty without indication Description : Paper empty error message does not display when the paper cassette is empty. 1. Bending or deformation of the actuator of the paper sensor. Replace the defective actuator. 2. The function of the engine board is defective Replace the engine board.

    Alignment & Troubleshooting 6) Cover Open Description : The ERROR lamp is on even samsung scx-4828fn lsu hsync error the print cover is closed. 1. The hook lever in the front cover or Guide rear may be defective. Replace the hook lever, if defective. 2. Check the connector and circuit of the cover switch department in the Main Control board. 1. Check the insertion of the 2. Replace the Main Control.

    Alignment & Troubleshooting 7) No error LED when the cover is open Description : The Error LED does not come on even when the printer cover is open 1. Check the connector and circuit of the cover switch department in the Main Control board. Perform EDC test 1. Check the insertion of the 2. Replace the Main Control.

    Alignment & Troubleshooting 8) No Power Description : When system power is turned on, all lamps on the operator panel do not come on. 1. Check if the power input and SMPS output are normal. Replace the power supply cord or SMPS. 2. Check the inferiority front-cover if the OP panel does not appear after normal warming-up. 1. Replace the control board. 2. Replace the OP panel.

    Alignment & Troubleshooting 9) Vertical Line Getting Curved Description : When printing, vertical line gets curved. unstable in the Main Control board EDC Mode: 2. Chect the Deve PBA in the Toner Cartridge. 1. Replace thetoner Joint PBA. 2. Replace the MainPBA.

    Alignment & Troubleshooting The cause and solutions of bad environment of the software 1) The printer is not working (1) Description : While Power turned on, the printer is not working in the printing mode. 1. Run Self-Test Mode: Turn the power on while pressing the test printing button for 2 or 3 seconds before printing works. Check the power of the printer and perform the Self-Test. If the test printing works, that means no problems in the printer itself. If the test printing does not work, that means bad functioning of the printer (not because of software). 2. Check if the PC and the printer is properly connected and the toner cartridge installed. Replace the printer cable. If the problems not solved even after the cable replaced, check the amount of the remaining tone. Check if the connection between PC and printer port is proper. If you use windows, check if the printer driver in the controller is set up. If the printer driver is properly set up, check in which program the printing is not working. The best way to find out is to open the memo pad to check the function of printing. If it is not working in a certain program, adjust the setup the program requires. Sometimes, programs, but it's not working in a particular program. In such case, install the new driver again. Check the setup of the port of CMOS is on ECP. And check the address of IRQ 7 and Check if the printer cable is directly connected to peripheral devices If the scanner needs to be connected to the printer, first the remove the scanner from the PC to see if the printer is properly working alone.

    Alignment & Troubleshooting 2) The printer is not working (2) Description : After receiving the printing order, no response at all or the low speed of printing occurs due to wrong setup of the environment rather than malfunction of the printer itself. 1. Secure more space of the hard disk. Not working with the message 'insufficient printer memory' means hard disk space problem rather than the RAM problem. In this case, provide more space for the hard disk. Secure more space using the disk utilities program. 2. Printing error occurs even if there is enough space samsung scx-4828fn lsu hsync error the hard disk. The connection of the cable and printer port is not proper. Check if the connection is properly done and if the parallel port in CMOS is rightly set up. 3. Check the parallel-port-related items in the CMOS Setup. As a printer port, Select ECP or SPP among SPP(Normal), ECP, and EPP modes(increase printing speed) SPP normal mode support 8-bit data transfer, while ECP Mode transfer the bit data. 4. Reboot the system to print. If the regular font is not printing, the cable or the printer driver may be defective. Turn the PC and printer off, and reboot the system to print again. If not solved, double-click the printer in my computer If the regular fonts are not printed this time again. the cable must be defective so replace the cable with new one.

    Alignment & Troubleshooting 3) Abnormal Printing Description : The printing is not working properly even when the cable has no problem. (even after the cable is replaced) If the printer won t work at all or the strange fonts are repeated, the printer driver may be defective or wrong setup in the CMOS Setup. 1. Set up the parallel port in the CMOS SETUP. Select SPP(Normal) or ECP Port the among ECP, EPP or SPP in the CMOS Setup. 2. Printer Driver Error. Check the printer in My Computer. (to see if the printer driver is compatible to the present driver or delete the old driver, if defective and reinstall the new driver) 3. Error message from insufficient memory. (The printing job sometimes stops or due to insufficient virtual memory, but it actually comes from the insufficient space of the hard disk.) Delete the unnecessary files to secure enough space of the hard disk and start printing job again.

    Alignment & Troubleshooting 4) SPOOL Error Description : To spool which stands for simultaneous peripheral operations online a computer document or task list (or job ) is to read it in and store it, usually on a hard disk or larger storage medium so that it can be printed or otherwise processed at a more 1. Insufficient space of the hard disk in the directory assigned for the basic spool. Delete the unnecessary files to provide more space to start printing job. 2. If the previous printing error not solved. If there are some files with the extension name of ****.jnl, Delete them and Reboot with other program. Shut down all other programs except the current one, if possible. program or the printer driver is damaged. Delete the printer driver completely and reinstall it. OS are damaged or virus infected. After rebooting the computer, check for viruses, restore the damaged files and reinstall the program to do the printing job. 6. Memory is less than suggested one. Add up enough memory to the PC. How to delete the data in the spool manager. In the spool manager, the installed drivers and the list of the documents waiting to be printed are shown. Select the document to be deleted and check the delete menu. If you intend to delete the current document being printed, the data being transferred to the printer will be put out and then the document is removed. Before choosing the document, the menu is still inactive. spool manager.

    Alignment & Troubleshooting Fax & Phone Problems 1) No Dial Tone Description : While on-hook button is pressed, there is no dial tone. 1. Check if the telephone line cord is connected to. If the telephone cord is normal but there is no dial tone, then try to Ass'y may be defective. Try to replace the OPE Ass'y. 3. Check the connection of Check the Speaker connection, and try to replace it. 4. Check if the SPEAKER is connected correctly., try to replace the Main B'd.

    Alignment & Troubleshooting 2) Defective MF DIAL Description : The MF DIAL is not functioning. 1. Check if the telephone line is connected correctly. Ass'y may be defective. Try to replace the OPE Ass'y. ON KEY is pressed, check to catch after checking the connection of the Main PBA, try to replace the 3. Check the connection of The problem still persists, then in sequence. Notes: Product supports the MF type only.

    Alignment & Troubleshooting 3) Defective FAX FORWARD/RECEIVE Description : The FAX FORWARD/RECEIVE is not functioning. 1. Check if you can catch a dial tone by pressing If the MODEM testing is normal and there is no dial tone, then try 2. Check if you can catch a RECEIVE tone while MODEM testing in the If the MODEM testing is abnormal, try to replace the Main B'd.

    Alignment & Troubleshooting 4) Defective FAX FORWARD Description : RECEIVE is functioning, but FORWARD is not functioning or the received data are broken. 1. Check if there is NOISE when pressing on-hook dial. If it makes NOISE while using on-hook dial, replace or repair the telephone line. 2. Check the RECEIVE condition by trying to forward a FAX to another fax machine from the forwarding side FAX, samsung scx-4828fn lsu hsync error. 3. Check if the telephone line connected to the Product is contaminated or gets stripped off or down.

    Alignment & Troubleshooting 5) Defective FAX RECEIVE (1) Description : FORWARD is functioning, but RECEIVE is not functioning or the received data are broken. sprers.eu if there is NOISE when pressing on-hook dial. If it makes NOISE while on-hooking, replace or repair the telephone line. sprers.eu the RECEIVE condition by samsung scx-4828fn lsu hsync error to receive a FAX at another fax machine.

    Alignment & Troubleshooting 6) Defective FAX RECEIVE (2) Description : The received data are lengthened or cut in the printing. 1. Check if there is NOISE when pressing on-hook dial. If it makes NOISE, rearrange the telephone line. (Refer to 'Defective FAX RECEIVE'.) 2. Ask to the forwarding side, check the image quality of another machine receiving a FAX additionally sent to. Check if the FAX status of the forwarding side is also normal.

    Alignment & Troubleshooting 7) Defective FAX RECEIVE (3) Description : The phone is ringing continuously, but it cannot receive. Check if the RECEIVE Mode is MODE or FAX MODE. Even when the RECEIVE Mode is changed to FAX MODE, it cannot the Main B'd in sequence.

    Alignment & Troubleshooting 8) Defective FAX RECEIVE (4) Description : The received data is reduced by more than 50% in the printing. Check the FAX status of the forwarding side. After checking the data of the forwarding side, correct the FAX of the forwarding side.

    Alignment & Troubleshooting 9) Defective Automatic Receiving Description : The automatic receiving function is not working. 1. Check if the RECEIVE Mode is MODE or FAX MODE. 1. If the RECEIVE Mode is set to the MODE, reset it to the FAX MODE. 2. Even after the RECEIVE Mode is changed to the FAX Mode, it cannot receive, then try to B'd in sequence.

    Alignment & Troubleshooting Copy Problems 1) Black Copy Description : Black page is printed out when copy. 1. Check the Scan-Cover open. Room light ca transit a thin original. 2. Check shading profile. Remake shading profile in the tech mode. 3. Check white/black reference voltage in Main PBA. Replace U60 if it is defective. U = V. U = V

    Alignment & Troubleshooting 2) White Copy Description : White page is printed out when Copy. 1. Check the CIS problem in Main PBA. Check the CIS harness contact. 2. Check shading profile. Remake shading profile in the tech mode.

    Alignment & Troubleshooting 3) Abnormal noise Description : There is noise when copy. 1. Check the Scanner Motor and any mechanical disturbance. Check the right position of the Scanner Motor, and check the any mechanical disturbance in the CIS carriage part. 2. Check the Motor Driver in Driver PBA. If any driver is defective, replace it. Connection PBA U, 19 or U, 19=0V to 24V swing signal when operating.

    Alignment & Troubleshooting 4) Defective Image Quality Description : The copied image is light or bad. 1. Check shading profile. Remake shading profile in the tech mode. 2. Check the gap between original and scanner glass. The gap above mm can cause a blurred image. 3. Check printing quality. See "Print" troubleshooting.

    Alignment & Troubleshooting Scanning Problems 1) Defective PC Scan Description : The PC Scan is not functioning at all. 1. Check the Cable (USB or Parallel) If the PC and the cable are not connected properly, reconnect it. 2. Check if the driver is installed properly. After confirming that it is proper by performing a PC printing test related to driver setup, if it is not so, reinstall it. (Refer to User's Manual.) 3. Check if copy function operates normally. If copy function works, replace the Main PBA. If copy function doesn't work, replace the CIS Ass'y and try again.

    Alignment & Troubleshooting 2) Defective Image Quality of PC Scan Samsung scx-4828fn lsu hsync error : The image PC scanned is not clear or bad. 1. Check the waveform form by performing a CIS test in If the CIS waveform form is abnormal, try to replace the CIS Ass'y. 2. Check if the resolution is set too low in PC Scan options. (Refer to User's Manual.) If the resolution is set to low, let the user be acquainted with the using method well.

    ExplodedView and Parts 5. ExplodedView and Parts Thumbnail Main Cover Ass y Cover Middle Frame Main Drive Scan Ass y ADF Ass y Platen Ass y OPE Unit Duplex Unit Fuser Cassette SCF DIGITAL LASER MFP The keynote of Product - Print/Copy Speed SCXFN : 24 ppm (A4) / 24 cpm (A4) SCXFN : 28 ppm (A4) / 28 cpm (A4) - Print resolrution : dpi effective output - CPU : Mhz - PCL5e, PCL6, IBM ProPrinter, EPSON PS(FN) - Memory SCXFN : 64MB(Max. MB) SCXFN : MB(Max. MB) - ADF samsung scx-4828fn lsu hsync error 30(FN) / 50(FN) Sheet - MP : 1 Sheet - Toner : 2K(Initial)/ 5K(Sales)

    View more

    0 Comments

    Leave a Comment